RegulonDB RegulonDB 10.9: Gene Form
   

spoT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

spoT trmH rpoZ TSS_4241 TSS_4241 TSS_4240 TSS_4240 TSS_4239 TSS_4239 TSS_4238 (cluster) TSS_4238 (cluster) TSS_4237 TSS_4237 TSS_4236 (cluster) TSS_4236 (cluster) TSS_4235 TSS_4235

Gene      
Name: spoT    Texpresso search in the literature
Synonym(s): ECK3640, EG10966, b3650
Genome position(nucleotides): 3822400 --> 3824508 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.72
Reference(s): [1] An G., et al., 1979
External database links:  
ASAP:
ABE-0011935
CGSC:
156
ECHOBASE:
EB0959
ECOLIHUB:
spoT
OU-MICROARRAY:
b3650
STRING:
511145.b3650
COLOMBOS: spoT


Product      
Name: bifunctional (p)ppGpp synthase/hydrolase SpoT
Synonym(s): SpoT
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 79.342
Isoelectric point: 9.004
Motif(s):
 
Type Positions Sequence
26 -> 175 AYLVARDAHEGQTRSSGEPYITHPVAVACILAEMKLDYETLMAALLHDVIEDTPATYQDMEQLFGKSVAELVEGVSKLDKLKFRDKKEAQAENFRKMIMAMVQDIRVILIKLADRTHNMRTLGSLRPDKRRRIARETLEIYSPLAHRLGI
45 -> 144 YITHPVAVACILAEMKLDYETLMAALLHDVIEDTPATYQDMEQLFGKSVAELVEGVSKLDKLKFRDKKEAQAENFRKMIMAMVQDIRVILIKLADRTHNM
235 -> 345 GREKHLYSIYCKMVLKEQRFHSIMDIYAFRVIVNDSDTCYRVLGQMHSLYKPRPGRVKDYIAIPKANGYQSLHTSMIGPHGVPVEVQIRTEDMDQMAEMGVAAHWAYKEHG
388 -> 447 IYVFTPEGRIVELPAGATPVDFAYAVHTDIGHACVGARVDRQPYPLSQPLTSGQTVEIIT
293 -> 293 D

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.33 - nucleotide and nucleoside conversions
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.4 - proteases, cleavage of compounds
  5 - cell processes --> 5.5 - adaptations --> 5.5.3 - starvation
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0008728 - GTP diphosphokinase activity
GO:0008893 - guanosine-3',5'-bis(diphosphate) 3'-diphosphatase activity
biological_process GO:0015949 - nucleobase-containing small molecule interconversion
GO:0042594 - response to starvation
GO:0016310 - phosphorylation
GO:0015969 - guanosine tetraphosphate metabolic process
GO:0015970 - guanosine tetraphosphate biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-29378N
ECOCYC:
SPOT-MONOMER
ECOLIWIKI:
b3650
INTERPRO:
IPR033655
INTERPRO:
IPR043519
INTERPRO:
IPR007685
INTERPRO:
IPR012675
INTERPRO:
IPR012676
INTERPRO:
IPR002912
INTERPRO:
IPR003607
INTERPRO:
IPR004095
INTERPRO:
IPR004811
MODBASE:
P0AG24
PANTHER:
PTHR21262
PFAM:
PF02824
PFAM:
PF13291
PFAM:
PF04607
PFAM:
PF13328
PRIDE:
P0AG24
PRODB:
PRO_000023977
PROSITE:
PS51880
PROSITE:
PS51671
PROSITE:
PS51831
REFSEQ:
NP_418107
SMART:
SM00954
SMART:
SM00471
UNIPROT:
P0AG24


Operon      
Name: rpoZ-spoT-trmH-recG         
Operon arrangement:
Transcription unit        Promoter
rpoZ-spoT-trmH-recG
recG


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4235 3822245 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4236 (cluster) 3822249 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_4237 3823562 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4238 (cluster) 3823568 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_4239 3823619 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4240 3824410 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4241 3824657 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] An G., Justesen J., Watson RJ., Friesen JD., 1979, Cloning the spoT gene of Escherichia coli: identification of the spoT gene product., J Bacteriol 137(3):1100-10

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB