RegulonDB RegulonDB 10.8: Gene Form
   

tyrP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tyrP yecA yecH TyrR TyrR anti-anti-terminator anti-terminator terminator yecHp5 yecHp5 tyrPp1 tyrPp1 yecHp3 yecHp3 TSS_2244 TSS_2244 TSS_2243 (cluster) TSS_2243 (cluster) tyrPp2 tyrPp2

Gene      
Name: tyrP    Texpresso search in the literature
Synonym(s): ECK1906, EG11041, b1907
Genome position(nucleotides): 1989681 --> 1990892 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.24
External database links:  
ASAP:
ABE-0006355
CGSC:
56
ECHOBASE:
EB1034
OU-MICROARRAY:
b1907
PortEco:
tyrP
STRING:
511145.b1907
COLOMBOS: tyrP


Product      
Name: tyrosine:H+ symporter
Synonym(s): TyrP, tyrosine ArAAP transporter
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 42.819
Isoelectric point: 9.604
Motif(s):
 
Type Positions Sequence
2 -> 390 KNRTLGSVFIVAGTTIGAGMLAMPLAAAGVGFSVTLILLIGLWALMCYTALLLLEVYQHVPADTGLGTLAKRYLGRYGQWLTGFSMMFLMYALTAAYISGAGELLASSISDWTGISMSATAGVLLFTFVAGGVVCVGTSLVDLFNRFLFSAKIIFLVVMLVLLLPHIHKVNLLTLPLQQGLALSAIPVIFTSFGFHGSVPSIVSYMDGNIRKLRWVFIIGSAIPLVAYIFWQVATLGSIDSTTFMGLLANHAGLNGLLQALREMVASPHVELAVHLFADLALATSFLGVALGLFDYLADLFQRSNTVGGRLQTGAITFLPPLAFALFYPRGFVMALGYAGVALAVLALIIPSLLTWQSRKHNPQAGYRVKGGRPALVVVFLCGIAVIGV
81 -> 101 WLTGFSMMFLMYALTAAYISG
275 -> 295 VHLFADLALATSFLGVALGLF
217 -> 237 VFIIGSAIPLVAYIFWQVATL
184 -> 204 LSAIPVIFTSFGFHGSVPSIV

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.14 - tyrosine
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0015173 - aromatic amino acid transmembrane transporter activity
biological_process GO:0006865 - amino acid transport
GO:0015801 - aromatic amino acid transport
GO:0003333 - amino acid transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48105N
ECOCYC:
TYRP-MONOMER
ECOLIWIKI:
b1907
INTERPRO:
IPR013061
INTERPRO:
IPR018227
INTERPRO:
IPR013059
MINT:
MINT-1305835
PANTHER:
PTHR46997
PFAM:
PF03222
PRIDE:
P0AAD4
PRINTS:
PR00166
PRODB:
PRO_000024152
PROSITE:
PS00594
REFSEQ:
NP_416420
UNIPROT:
P0AAD4


Operon      
Name: tyrP         
Operon arrangement:
Transcription unit        Promoter
tyrP
tyrP


Transcriptional Regulation      
Display Regulation             
Activated by: TyrR
Repressed by: TyrR, IHF, HU


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2243 (cluster) 1989510 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2244 1989562 reverse nd [RS-EPT-CBR] [1]
  promoter yecHp3 1989564 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yecHp5 1989652 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB