RegulonDB RegulonDB 10.9: Gene Form
   

xseA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

der guaB xseA yfgJ CRP MarA PurR Fis Fis Fis DnaA terminator terminator TSS_2793 TSS_2793 TSS_2792 TSS_2792 xseAp xseAp guaBp guaBp TSS_2790 TSS_2790 TSS_2789 TSS_2789 TSS_2788 (cluster) TSS_2788 (cluster) TSS_2787 TSS_2787 TSS_2786 TSS_2786 TSS_2785 TSS_2785

Gene      
Name: xseA    Texpresso search in the literature
Synonym(s): ECK2505, EG11072, b2509, xse
Genome position(nucleotides): 2634232 --> 2635602 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.25
External database links:  
ASAP:
ABE-0008263
CGSC:
6
ECHOBASE:
EB1065
ECOLIHUB:
xseA
OU-MICROARRAY:
b2509
STRING:
511145.b2509
COLOMBOS: xseA


Product      
Name: exodeoxyribonuclease VII subunit XseA
Synonym(s): Xse, XseA, exonuclease VII, large subunit
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 51.832
Isoelectric point: 10.555
Motif(s):
 
Type Positions Sequence
10 -> 103 FTVSRLNQTVRLLLEHEMGQVWISGEISNFTQPASGHWYFTLKDDTAQVRCAMFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQ
126 -> 440 LFDQQYKKPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPAAVQGDDAPGQIVRAIELANQRNECDVLIVGRGGGSLEDLWSFNDERVARAIFTSRIPVVSAVGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSTRQRLEMAMDYYLANRTRRFTQIHHRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRTGQQQQRLTQRLNQQNPQPKIHRAQTRIQQLEYRLAETLRAQLSATRERFGNAVTHLEAVSPLSTLARGYSVTTATDGNVLKKVKQVKAGEMLTTRLEDGWIES
67 -> 67 N

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.2 - degradation of macromolecules --> 1.2.2 - DNA
  2 - information transfer --> 2.1 - DNA related --> 2.1.5 - DNA degradation
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0009318 - exodeoxyribonuclease VII complex
molecular_function GO:0003676 - nucleic acid binding
GO:0004518 - nuclease activity
GO:0004527 - exonuclease activity
GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0008855 - exodeoxyribonuclease VII activity
biological_process GO:0006308 - DNA catabolic process
GO:0090305 - nucleic acid phosphodiester bond hydrolysis
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11146N
ECOCYC:
EG11072-MONOMER
ECOLIWIKI:
b2509
INTERPRO:
IPR025824
INTERPRO:
IPR020579
INTERPRO:
IPR003753
PANTHER:
PTHR30008
PFAM:
PF02601
PFAM:
PF13742
PRIDE:
P04994
PRODB:
PRO_000024237
REFSEQ:
NP_417004
SMR:
P04994
UNIPROT:
P04994


Operon      
Name: xseA         
Operon arrangement:
Transcription unit        Promoter
xseA


Transcriptional Regulation      
Display Regulation             
Activated by: MarA
Repressed by: CRP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2785 2633290 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2786 2634070 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2787 2634090 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2788 (cluster) 2634100 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2789 2634102 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2790 2634105 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2792 2636300 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2793 2636452 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB