RegulonDB RegulonDB 10.8: Gene Form
   

xylB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

xylB xylA yiaB anti-terminator terminator yiaBp6 yiaBp6 yiaBp1 yiaBp1 yiaBp5 yiaBp5

Gene      
Name: xylB    Texpresso search in the literature
Synonym(s): ECK3553, EG11075, b3564
Genome position(nucleotides): 3727917 <-- 3729371 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.78
External database links:  
ASAP:
ABE-0011637
CGSC:
4
ECHOBASE:
EB1068
OU-MICROARRAY:
b3564
PortEco:
xylB
STRING:
511145.b3564
COLOMBOS: xylB


Product      
Name: xylulokinase
Synonym(s): XylB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 52.618
Isoelectric point: 5.588
Motif(s):
 
Type Positions Sequence
6 -> 6 D
233 -> 233 D
249 -> 435 AMLSLGTSGVYFAVSEGFLSKPESAVHSFCHALPQRWHLMSVMLSAASCLDWAAKLTGLSNVPALIAAAQQADESAEPVWFLPYLSGERTPHNNPQAKGVFFGLTHQHGPNELARAVLEGVGYALADGMDVVHACGIKPQSVTLIGGGARSEYWRQMLADISGQQLDYRTGGDVGPALGAARLAQIA
77 -> 78 MH
1 -> 240 MYIGIDLGTSGVKVILLNEQGEVVAAQTEKLTVSRPHPLWSEQDPEQWWQATDRAMKALGDQHSLQDVKALGIAGQMHGATLLDAQQRVLRPAILWNDGRCAQECTLLEARVPQSRVITGNLMMPGFTAPKLLWVQRHEPEIFRQIDKVLLPKDYLRLRMTGEFASDMSDAAGTMWLDVAKRDWSDVMLQACDLSRDQMPALYEGSEITGALLPEVAKAWGMATVPVVAGGGDNAAGAVG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0016773 - phosphotransferase activity, alcohol group as acceptor
GO:0004856 - xylulokinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0042803 - protein homodimerization activity
biological_process GO:0008152 - metabolic process
GO:0005975 - carbohydrate metabolic process
GO:0005997 - xylulose metabolic process
GO:0005998 - xylulose catabolic process
GO:0016310 - phosphorylation
GO:0042732 - D-xylose metabolic process
GO:0042843 - D-xylose catabolic process
GO:0046835 - carbohydrate phosphorylation
Note(s): Note(s): ...[more].
Reference(s): [1] Bork P., et al., 1992
[2] Lawlis VB., et al., 1984
[3] Maleszka R., et al., 1982
[4] Rosenfeld SA., et al., 1984
[5] Stevis PE., et al., 1988
[6] Wovcha MG., et al., 1983
External database links:  
ECOCYC:
XYLULOKIN-MONOMER
ECOLIWIKI:
b3564
INTERPRO:
IPR000577
INTERPRO:
IPR018485
INTERPRO:
IPR018484
INTERPRO:
IPR018483
INTERPRO:
IPR006000
MODBASE:
P09099
PDB:
2NLX
PDB:
2ITM
PFAM:
PF02782
PFAM:
PF00370
PRIDE:
P09099
PROSITE:
PS00933
PROSITE:
PS00445
REFSEQ:
NP_418021
SMR:
P09099
UNIPROT:
P09099


Operon      
Name: xylAB         
Operon arrangement:
Transcription unit        Promoter
xylAB


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, XylR
Repressed by: AraC


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yiaBp5 3727767 reverse Similarity to the consensus
Read more >
[ICWHO] [7]
  promoter yiaBp1 3727797 reverse Similarity to the consensus
Read more >
[ICWHO] [7]
  promoter yiaBp6 3727827 reverse Similarity to the consensus
Read more >
[ICWHO] [7]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Bork P., Sander C., Valencia A., 1992, An ATPase domain common to prokaryotic cell cycle proteins, sugar kinases, actin, and hsp70 heat shock proteins., Proc Natl Acad Sci U S A 89(16):7290-4

 [2] Lawlis VB., Dennis MS., Chen EY., Smith DH., Henner DJ., 1984, Cloning and sequencing of the xylose isomerase and xylulose kinase genes of Escherichia coli., Appl Environ Microbiol 47(1):15-21

 [3] Maleszka R., Wang PY., Schneider H., 1982, A Col E1 hybrid plasmid containing Escherichia coli genes complementing d-xylose negative mutants of Escherichia coli and Salmonella typhimurium., Can J Biochem 60(2):144-51

 [4] Rosenfeld SA., Stevis PE., Ho NW., 1984, Cloning and characterization of the xyl genes from Escherichia coli., Mol Gen Genet 194(3):410-5

 [5] Stevis PE., Ho NW., 1988, A novel xylB-based positive selection vector., Plasmid 20(1):92-5

 [6] Wovcha MG., Steuerwald DL., Brooks KE., 1983, Amplification of D-xylose and D-glucose isomerase activities in Escherichia coli by gene cloning., Appl Environ Microbiol 45(4):1402-4

 [7] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB