RegulonDB RegulonDB 10.8: Gene Form
   

rihC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ispH rihC dapB nc9 ArgP ArgP dapBp1 dapBp1 TSS_75 TSS_75 dapBp2 dapBp2 TSS_73 TSS_73

Gene      
Name: rihC    Texpresso search in the literature
Synonym(s): ECK0031, EG11082, b0030, yaaF
Genome position(nucleotides): 27293 --> 28207 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.28
External database links:  
ASAP:
ABE-0000109
ECHOBASE:
EB1074
OU-MICROARRAY:
b0030
PortEco:
rihC
STRING:
511145.b0030
COLOMBOS: rihC


Product      
Name: ribonucleoside hydrolase RihC
Synonym(s): RihC, YaaF, ribonucleoside hydrolase 3
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 32.561
Isoelectric point: 5.092
Motif(s):
 
Type Positions Sequence
4 -> 293 PIFLDTDPGIDDAVAIAAAIFAPELDLQLMTTVAGNVSVEKTTRNALQLLHFWNAEIPLAQGAAVPLVRAPRDAASVHGESGMAGYDFVEHNRKPLGIPAFLAIRDALMRAPEPVTLVAIGPLTNIALLLSQCPECKPYIRRLVIMGGSAGRGNCTPNAEFNIAADPEAAACVFRSGIEIVMCGLDVTNQAILTPDYLSTLPQLNRTGKMLHALFSHYRSGSMQSGLRMHDLCAIAWLVRPDLFTLKPCFVAVETQGEFTSGTTVVDIDGCLGKPANVQVALDLDVKGFQ

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.33 - nucleotide and nucleoside conversions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016787 - hydrolase activity
GO:0016798 - hydrolase activity, acting on glycosyl bonds
GO:0008477 - purine nucleosidase activity
GO:0016799 - hydrolase activity, hydrolyzing N-glycosyl compounds
GO:0045437 - uridine nucleosidase activity
GO:0047622 - adenosine nucleosidase activity
GO:0047724 - inosine nucleosidase activity
GO:0050263 - ribosylpyrimidine nucleosidase activity
biological_process GO:0008152 - metabolic process
GO:0006206 - pyrimidine nucleobase metabolic process
GO:0006974 - cellular response to DNA damage stimulus
GO:0006152 - purine nucleoside catabolic process
GO:0006144 - purine nucleobase metabolic process
GO:0042454 - ribonucleoside catabolic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11157N
ECOCYC:
EG11082-MONOMER
ECOLIWIKI:
b0030
INTERPRO:
IPR023186
INTERPRO:
IPR036452
INTERPRO:
IPR022976
INTERPRO:
IPR015910
INTERPRO:
IPR001910
MINT:
MINT-1268238
MODBASE:
P22564
PANTHER:
PTHR12304
PFAM:
PF01156
PRIDE:
P22564
PRODB:
PRO_000023758
PROSITE:
PS01247
REFSEQ:
NP_414571
SMR:
P22564
SWISSMODEL:
P22564
UNIPROT:
P22564


Operon      
Name: rihC         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_73 27263 forward nd [RS-EPT-CBR] [1]
  promoter TSS_75 28293 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB