RegulonDB RegulonDB 10.8: Gene Form
   

acpH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

malZ queA acpH Fis ppGpp terminator anti-terminator anti-anti-terminator TSS_510 TSS_510 tgtp tgtp queAp queAp

Gene      
Name: acpH    Texpresso search in the literature
Synonym(s): ECK0398, EG11095, b0404, yajB
Genome position(nucleotides): 424337 <-- 424918 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.09
External database links:  
ASAP:
ABE-0001404
ECHOBASE:
EB1087
OU-MICROARRAY:
b0404
PortEco:
acpH
STRING:
511145.b0404
COLOMBOS: acpH


Product      
Name: acyl carrier protein phosphodiesterase
Synonym(s): AcpH, YajB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 22.961
Isoelectric point: 6.3
Motif(s):
 
Type Positions Sequence
81 -> 186 WDHFLSRHWSQLSPDFPLQEFVCYAREQVMTILPDSPPRFINLNNYLWSEQWLVRYRDMDFIQNVLNGMASRRPRLDALRDSWYDLDAHYDALETRFWQFYPRMMA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.15 - large molecule carriers --> 1.6.15.4 - acyl carrier protein
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016787 - hydrolase activity
GO:0008770 - [acyl-carrier-protein] phosphodiesterase activity
biological_process GO:0006629 - lipid metabolic process
GO:0006631 - fatty acid metabolic process
GO:0006633 - fatty acid biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11095-MONOMER
ECOLIWIKI:
b0404
INTERPRO:
IPR007431
INTERPRO:
IPR023491
PANTHER:
PTHR38764
PFAM:
PF04336
PRIDE:
P21515
PRODB:
PRO_000022044
REFSEQ:
NP_414938
UNIPROT:
P21515


Operon      
Name: acpH         
Operon arrangement:
Transcription unit        Promoter
acpH


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_510 426062 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB