RegulonDB RegulonDB 10.8: Gene Form
   

yajC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

secD tgt yajC TSS_517 TSS_517 TSS_516 TSS_516 TSS_515 TSS_515 TSS_514 (cluster) TSS_514 (cluster) TSS_513 TSS_513 TSS_512 TSS_512 yajCp yajCp TSS_511 TSS_511

Gene      
Name: yajC    Texpresso search in the literature
Synonym(s): ECK0401, EG11096, b0407
Genome position(nucleotides): 427287 --> 427619 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.55
External database links:  
ASAP:
ABE-0001415
ECHOBASE:
EB1088
OU-MICROARRAY:
b0407
PortEco:
yajC
STRING:
511145.b0407
COLOMBOS: yajC


Product      
Name: Sec translocon accessory complex subunit YajC
Synonym(s): YajC
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 11.887
Isoelectric point: 10.218
Motif(s):
 
Type Positions Sequence
82 -> 82 A
22 -> 99 SLILMLVVFGLIFYFMILRPQQKRTKEHKKLMDSIAKGDEVLTNGGLVGRVTKVAENGYIAIALNDTTEVVIKRDFVA
19 -> 39 SPMSLILMLVVFGLIFYFMIL

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.5 - The Type II (General) Secretory Pathway (IISP) Family
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0031522 - cell envelope Sec protein transport complex
molecular_function GO:0005515 - protein binding
biological_process GO:0015031 - protein transport
Note(s): Note(s): ...[more].
Evidence: [IGI] Inferred from genetic interaction
[IPI] Inferred from physical interaction
Reference(s): [1] Duong F., et al., 1997
[2] Duong F., et al., 1997
[3] Kato Y., et al., 2003
[4] Muller M., et al., 2001
[5] Nouwen N., et al., 2002
[6] Nouwen N., et al., 2001
[7] Pogliano KJ., et al., 1994
[8] Scotti PA., et al., 2000
[9] Taura T., et al., 1994
External database links:  
DIP:
DIP-29531N
ECOCYC:
EG11096-MONOMER
ECOLIWIKI:
b0407
INTERPRO:
IPR003849
PANTHER:
PTHR33909
PDB:
2RDD
PFAM:
PF02699
PRIDE:
P0ADZ7
PRINTS:
PR01853
REFSEQ:
NP_414941
SMART:
SM01323
SMR:
P0ADZ7
UNIPROT:
P0ADZ7


Operon      
Name: tgt-yajC-secDF         
Operon arrangement:
Transcription unit        Promoter
tgt-yajC
yajC-secDF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_511 427204 forward nd [RS-EPT-CBR] [10]
  promoter TSS_512 427649 forward nd [RS-EPT-CBR] [10]
  promoter TSS_513 428779 forward nd [RS-EPT-CBR] [10]
  promoter TSS_514 (cluster) 428782 forward For this promoter, there
Read more >
[RS-EPT-CBR] [10]
  promoter TSS_515 428786 forward nd [RS-EPT-CBR] [10]
  promoter TSS_516 429239 forward nd [RS-EPT-CBR] [10]
  promoter TSS_517 429370 forward nd [RS-EPT-CBR] [10]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Duong F., Wickner W., 1997, Distinct catalytic roles of the SecYE, SecG and SecDFyajC subunits of preprotein translocase holoenzyme., EMBO J 16(10):2756-68

 [2] Duong F., Wickner W., 1997, The SecDFyajC domain of preprotein translocase controls preprotein movement by regulating SecA membrane cycling., EMBO J 16(16):4871-9

 [3] Kato Y., Nishiyama K., Tokuda H., 2003, Depletion of SecDF-YajC causes a decrease in the level of SecG: implication for their functional interaction., FEBS Lett 550(1-3):114-8

 [4] Muller M., Koch HG., Beck K., Schafer U., 2001, Protein traffic in bacteria: multiple routes from the ribosome to and across the membrane., Prog Nucleic Acid Res Mol Biol 66:107-57

 [5] Nouwen N., Driessen AJ., 2002, SecDFyajC forms a heterotetrameric complex with YidC., Mol Microbiol 44(5):1397-405

 [6] Nouwen N., van der Laan M., Driessen AJ., 2001, SecDFyajC is not required for the maintenance of the proton motive force., FEBS Lett 508(1):103-6

 [7] Pogliano KJ., Beckwith J., 1994, Genetic and molecular characterization of the Escherichia coli secD operon and its products., J Bacteriol 176(3):804-14

 [8] Scotti PA., Urbanus ML., Brunner J., de Gier JW., von Heijne G., van der Does C., Driessen AJ., Oudega B., Luirink J., 2000, YidC, the Escherichia coli homologue of mitochondrial Oxa1p, is a component of the Sec translocase., EMBO J 19(4):542-9

 [9] Taura T., Akiyama Y., Ito K., 1994, Genetic analysis of SecY: additional export-defective mutations and factors affecting their phenotypes., Mol Gen Genet 243(3):261-9

 [10] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB