RegulonDB RegulonDB 10.7: Gene Form
   

hyfA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hyfB hyfC hyfA bcp FNR FhlA HyfR CRP hyfAp hyfAp

Gene      
Name: hyfA    Texpresso search in the literature
Synonym(s): ECK2477, EG11150, b2481, yffE
Genome position(nucleotides): 2601201 --> 2601818 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.31
Reference(s): [1] Andrews SC., et al., 1997
External database links:  
ASAP:
ABE-0008179
ECHOBASE:
EB1139
OU-MICROARRAY:
b2481
PORTECO:
hyfA
REGULONDB:
b2481
STRING:
511145.b2481
M3D: hyfA
COLOMBOS: hyfA
PortEco: b2481


Product      
Name: hydrogenase 4 component A
Synonym(s): HyfA, YffE
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 22.154
Isoelectric point: 6.478
Motif(s):
 
Type Positions Sequence
73 -> 102 DAIQLNESLCIGCKLCAVVCPFGAISASGS
2 -> 31 NRFVVAEPLWCTGCNTCLAACSDVHKTQGL
76 -> 98 QLNESLCIGCKLCAVVCPFGAIS
41 -> 72 KTSTITAPVVCHHCEEAPCLQVCPVNAISQRD
51 -> 67 CHHCEEAPCLQVCPVNA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
Gene Ontology Terms (GO)  
cellular_component GO:0044569 - [Ni-Fe] hydrogenase complex
molecular_function GO:0017113 - dihydropyrimidine dehydrogenase (NADP+) activity
GO:0002058 - uracil binding
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0050661 - NADP binding
biological_process GO:0055114 - oxidation-reduction process
GO:0006212 - uracil catabolic process
GO:0006210 - thymine catabolic process
Note(s): Note(s): ...[more].
Reference(s): [1] Andrews SC., et al., 1997
External database links:  
DIP:
DIP-9983N
ECOCYC:
MONOMER0-152
ECOLIWIKI:
b2481
INTERPRO:
IPR017896
INTERPRO:
IPR017900
MODBASE:
P23481
PFAM:
PF00037
PFAM:
PF12798
PRIDE:
P23481
PRODB:
PRO_000022963
PROSITE:
PS51379
PROSITE:
PS00198
PROTEINMODELPORTAL:
P23481
REFSEQ:
NP_416976
SMR:
P23481
UNIPROT:
P23481


Operon      
Name: hyfABCDEFGHIJR-focB         
Operon arrangement:
Transcription unit        Promoter
hyfABCDEFGHIJR-focB


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, FhlA, HyfR
Repressed by: FNR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Andrews SC., Berks BC., McClay J., Ambler A., Quail MA., Golby P., Guest JR., 1997, A 12-cistron Escherichia coli operon (hyf) encoding a putative proton-translocating formate hydrogenlyase system., Microbiology 143 ( Pt 11):3633-47


RegulonDB