RegulonDB RegulonDB 10.10: Gene Form
   

ygiB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: ygiB    Texpresso search in the literature
Synonym(s): ECK3028, EG11164, b3037
Genome position(nucleotides): 3179744 --> 3180415 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.1
External database links:  
ASAP:
ABE-0009969
ECHOBASE:
EB1152
ECOLIHUB:
ygiB
OU-MICROARRAY:
b3037
STRING:
511145.b3037
COLOMBOS: ygiB


Product      
Name: DUF1190 domain-containing protein YgiB
Synonym(s): YgiB
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 23.479
Isoelectric point: 9.765
Motif(s):
 
Type Positions Sequence
42 -> 209 ETVSLYQNADDCSAANPGKSAECTTAYNNALKEAERTAPKYATREDCVAEFGEGQCQQAPAQAGMAPENQAQAQQSSGSFWMPLMAGYMMGRLMGGGAGFAQQPLFSSKNPASPAYGKYTDATGKNYGAAQPGRTMTVPKTAMAPKPATTTTVTRGGFGESVAKQSTM

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
biological_process GO:0044010 - single-species biofilm formation
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Beloin C., et al., 2004
External database links:  
ECOCYC:
EG11164-MONOMER
ECOLIWIKI:
b3037
INTERPRO:
IPR009576
PFAM:
PF06693
PRIDE:
P0ADT2
REFSEQ:
NP_417509
UNIPROT:
P0ADT2


Operon      
Name: tolC-ygiBC         
Operon arrangement:
Transcription unit        Promoter
tolC-ygiBC
tolC-ygiBC
tolC-ygiBC
tolC-ygiBC


Transcriptional Regulation      
Display Regulation             
Activated by: MarA, PhoP, Rob, SoxS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3336 3178133 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3337 3178889 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3338 3179055 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3339 3179717 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3340 3180436 forward nd [RS-EPT-CBR] [2]



RegulonDB