RegulonDB RegulonDB 10.9: Gene Form
   

yhfA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: yhfA    Texpresso search in the literature
Synonym(s): ECK3344, EG11182, b3356
Genome position(nucleotides): 3485414 <-- 3485818 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.6
External database links:  
ASAP:
ABE-0010964
ECHOBASE:
EB1169
ECOLIHUB:
yhfA
OU-MICROARRAY:
b3356
STRING:
511145.b3356
COLOMBOS: yhfA


Product      
Name: OsmC family protein YhfA
Synonym(s): YhfA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 14.517
Isoelectric point: 5.614
Motif(s):
 
Type Positions Sequence
30 -> 127 GDKAPSPMEMVLMAAGGCSAIDVVSILQKGRQDVVDCEVKLTSERREEAPRLFTHINLHFIVTGRDLKDAAVARAVDLSAEKYCSVALMLEKAVNITH
77 -> 79 EAP

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48201N
ECOCYC:
EG11182-MONOMER
ECOLIWIKI:
b3356
INTERPRO:
IPR003718
INTERPRO:
IPR036102
INTERPRO:
IPR015946
MODBASE:
P0ADX1
PDB:
1ML8
PFAM:
PF02566
PRIDE:
P0ADX1
REFSEQ:
NP_417815
SMR:
P0ADX1
SWISSMODEL:
P0ADX1
UNIPROT:
P0ADX1


Operon      
Name: yhfA         
Operon arrangement:
Transcription unit        Promoter
yhfA


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: CRP


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3953 (cluster) 3485846 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_3954 3485952 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3956 3486049 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3957 (cluster) 3486051 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_3958 3486110 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3959 3486595 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3960 (cluster) 3486615 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_3961 (cluster) 3486621 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]



RegulonDB