RegulonDB RegulonDB 10.9: Gene Form
   

yigA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

xerC dapF yigB yigA yifL TSS_4472 TSS_4472 TSS_4471 TSS_4471 TSS_4470 TSS_4470 TSS_4469 TSS_4469 TSS_4468 (cluster) TSS_4468 (cluster)

Gene      
Name: yigA    Texpresso search in the literature
Synonym(s): ECK3805, EG11201, b3810
Genome position(nucleotides): 3995583 --> 3996290 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.79
External database links:  
ASAP:
ABE-0012444
ECHOBASE:
EB1186
ECOLIHUB:
yigA
OU-MICROARRAY:
b3810
STRING:
511145.b3810
COLOMBOS: yigA


Product      
Name: DUF484 domain-containing protein YigA
Synonym(s): YigA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 26.729
Isoelectric point: 6.517
Motif(s):
 
Type Positions Sequence
11 -> 232 TLTELDDRAVVDYLIKNPEFFIRNARAVEAIRVPHPVRGTVSLVEWHMARARNHIHVLEENMALLMEQAIANEGLFYRLLYLQRSLTAASSLDDMLMRFHRWARDLGLAGASLRLFPDRWRLGAPSNHTHLALSRQSFEPLRIQRLGQEQHYLGPLNGPELLVVLPEAKAVGSVAMSMLGSDADLGVVLFTSRDASHYQQGQGTQLLHEIALMLPELLERWI

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12478N
ECOCYC:
EG11201-MONOMER
ECOLIWIKI:
b3810
INTERPRO:
IPR029016
INTERPRO:
IPR007435
PANTHER:
PTHR38765
PFAM:
PF04340
PRIDE:
P23305
REFSEQ:
NP_418255
SMR:
P23305
UNIPROT:
P23305


Operon      
Name: yifL-dapF-yigA-xerC-yigB         
Operon arrangement:
Transcription unit        Promoter
yifL-dapF-yigA-xerC-yigB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4468 (cluster) 3995868 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_4469 3995958 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4470 3996295 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4471 3996562 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4472 3997751 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB