RegulonDB RegulonDB 10.9: Gene Form
   

yihA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yihA csrC spf CRP UvrY CRP CRP terminator csrCp csrCp yihAp9 yihAp9 TSS_4540 (cluster) TSS_4540 (cluster) spfp spfp

Gene      
Name: yihA    Texpresso search in the literature
Synonym(s): ECK3857, EG11203, b3865, engB
Genome position(nucleotides): 4050133 <-- 4050765 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.66
External database links:  
ASAP:
ABE-0012623
ECHOBASE:
EB1188
ECOLIHUB:
yihA
OU-MICROARRAY:
b3865
STRING:
511145.b3865
COLOMBOS: yihA


Product      
Name: GTP-binding protein YihA
Synonym(s): EngB, YihA, cell division protein; putative checkpoint GTPase
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 23.561
Isoelectric point: 7.761
Motif(s):
 
Type Positions Sequence
33 -> 40 GRSNAGKS
60 -> 64 GRTQL
178 -> 180 FSS
25 -> 199 TGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEVADGKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHPLKDLDQQMIEWAVDSNIAVLVLLTKADKLASGARKAQLNMVREAVLAFNGDVQVETFSSLKKQGVDKLRQKLDTWFSE
28 -> 146 EVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEVADGKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHPLKDLDQQMIEWAVDSNIAVLVLLTK

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.1 - cell division
  5 - cell processes --> 5.2 - cell cycle physiology
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0046872 - metal ion binding
GO:0000166 - nucleotide binding
GO:0005525 - GTP binding
biological_process GO:0000910 - cytokinesis
GO:0051301 - cell division
GO:0007049 - cell cycle
GO:0000917 - division septum assembly
GO:0090529 - cell septum assembly
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
[IMP] Inferred from mutant phenotype
Reference(s): [1] Dassain M., et al., 1999
[2] Wang B., et al., 2003
External database links:  
DIP:
DIP-48178N
ECOCYC:
EG11203-MONOMER
ECOLIWIKI:
b3865
INTERPRO:
IPR019987
INTERPRO:
IPR030393
INTERPRO:
IPR027417
INTERPRO:
IPR006073
MODBASE:
P0A6P7
PDB:
1PUI
PFAM:
PF01926
PRIDE:
P0A6P7
PROSITE:
PS51706
REFSEQ:
NP_418301
SMR:
P0A6P7
UNIPROT:
P0A6P7


Operon      
Name: yihA         
Operon arrangement:
Transcription unit        Promoter
yihA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4540 (cluster) 4050794 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter yihAp9 4050985 reverse Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Dassain M., Leroy A., Colosetti L., Carole S., Bouche JP., 1999, A new essential gene of the 'minimal genome' affecting cell division., Biochimie 81(8-9):889-95

 [2] Wang B., Kuramitsu HK., 2003, Assessment of the utilization of the antisense RNA strategy to identify essential genes in heterologous bacteria., FEMS Microbiol Lett 220(2):171-6

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB