RegulonDB RegulonDB 10.9: Gene Form
   

arpA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

arpA aceK iclR aceK-int metHp2 metHp2 arpAp9 arpAp9 arpAp1 arpAp1 arpAp8 arpAp8

Gene      
Name: arpA    Texpresso search in the literature
Synonym(s): ECK4009, EG11208, arp, b4017, yjaC
Genome position(nucleotides): 4220301 <-- 4222487 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
37.63
External database links:  
ASAP:
ABE-0013133
ECHOBASE:
EB1193
ECOLIHUB:
arpA
OU-MICROARRAY:
b4017
STRING:
511145.b4017
COLOMBOS: arpA


Product      
Name: regulator of acetyl CoA synthetase
Synonym(s): Arp, ArpA, YjaC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 82.598
Isoelectric point: 8.434
Motif(s):
 
Type Positions Sequence
701 -> 728 GFTDNPRYIAEKNYMEALLKKASPHTVR
123 -> 379 LNLKSDRKEKEFPRIKLNGQCYFPGRPQNRIVCRHIAAQYINDIYQNVDYKPHQDDYSSAEKFLTHFNKKCKNQTLALVSSRPEGRCVAACGDFGLVMKAYFDKMESNGISVMAAILLVDNHALTVRLRIKNTTEGCTHYVVSVYDPNVTNDKIRIMSESKENIKHYSLMDFMNVDYSLLKWSNDHVINQSVAIIPALPKEQLLMLKGSVDEITPPLSPATMNLLMAIGQNHQLTQLMIQLQKMPELHRTEMLTAYN
124 -> 124 N
525 -> 554 YGCPGLYLAMQNGHSDIVKVILEALPSLAQ
381 -> 410 INLPGLYLAINYGNADIVETIFNSLSETGY

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.4 - fatty acids and phosphatidic acid
  3 - regulation --> 3.1 - type of regulation --> 3.1.4 - unknown
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9159N
ECOCYC:
EG11208-MONOMER
ECOLIWIKI:
b4017
INTERPRO:
IPR002110
INTERPRO:
IPR036770
INTERPRO:
IPR012927
PFAM:
PF07906
PRIDE:
P23325
PROSITE:
PS50297
REFSEQ:
NP_418441
SMART:
SM00248
UNIPROT:
P23325


Operon      
Name: arpA         
Operon arrangement:
Transcription unit        Promoter
arpA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4837 4217361 forward nd [RS-EPT-CBR] [1]
  promoter arpAp8 4222513 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter arpAp1 4222629 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter arpAp9 4222691 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB