RegulonDB RegulonDB 10.10: Gene Form
   

rdcA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rdcA proP rdcB yjdM Fis Fis CRP CRP TSS_4918 TSS_4918 TSS_4917 TSS_4917 TSS_4916 TSS_4916 TSS_4915 TSS_4915 TSS_4914 TSS_4914 proPp2 proPp2 TSS_4913 TSS_4913 TSS_4912 TSS_4912 proPp1 proPp1 TSS_4910 TSS_4910 rdcAp1 rdcAp1 rdcAp2 rdcAp2 yjdMp5 yjdMp5 TSS_4909 (cluster) TSS_4909 (cluster)

Gene      
Name: rdcA    Texpresso search in the literature
Synonym(s): ECK4102, EG11210, b4109, crfC, yjdA
Genome position(nucleotides): 4327135 --> 4329363 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.46
External database links:  
ASAP:
ABE-0013456
ECHOBASE:
EB1195
ECOLIHUB:
yjdA
OU-MICROARRAY:
b4109
STRING:
469008.ECD_03980
COLOMBOS: rdcA


Product      
Name: regulator of diguanylate cyclase RdcA
Synonym(s): CrfC, RdcA, YjdA, clamp-binding protein CrfC, clamp-binding sister replication fork colocalization protein
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,bacterial nucleoid
Molecular weight: 84.371
Isoelectric point: 5.677
Motif(s):
 
Type Positions Sequence
72 -> 277 LAIVGTMKAGKSTTINAIVGTEVLPNRNRPMTALPTLIRHTPGQKEPVLHFSHVAPIDCLIQQLQQRLRDCDIKHLTDVLEIDKDMRALMQRIENGVAFEKYYLGAQPIFHCLKSLNDLVRLAKALDVDFPFSAYAAIEHIPVIEVEFVHLAGLESYPGQLTLLDTPGPNEAGQPHLQKMLNQQLARASAVLAVLDYTQLKSISDE
297 -> 300 NKFD
331 -> 334 FPVS
76 -> 83 GTMKAGKS
734 -> 734 Q

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.3 - inhibition / activation of enzymes
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0043590 - bacterial nucleoid
molecular_function GO:0005515 - protein binding
GO:0043022 - ribosome binding
GO:0003924 - GTPase activity
GO:0005525 - GTP binding
GO:0042802 - identical protein binding
biological_process GO:0006260 - DNA replication
GO:0000027 - ribosomal large subunit assembly
GO:0007059 - chromosome segregation
GO:1900231 - regulation of single-species biofilm formation on inanimate substrate
External database links:  
ECOCYC:
EG11210-MONOMER
ECOLIWIKI:
b4109
INTERPRO:
IPR027417
INTERPRO:
IPR030381
INTERPRO:
IPR022812
MODBASE:
P16694
PFAM:
PF00350
PRIDE:
P0DM85
PROSITE:
PS51718
REFSEQ:
NP_418533
SMR:
P0DM85
UNIPROT:
P0DM85


Operon      
Name: rdcAB         
Operon arrangement:
Transcription unit        Promoter
rdcAB
rdcAB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4909 (cluster) 4326796 reverse nd [RS-EPT-CBR] [1]
  promoter yjdMp5 4326836 reverse nd [ICWHO] [2]
  promoter TSS_4910 4329587 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4912 4330352 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4913 4330392 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4914 4330838 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4915 4330987 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4916 4331343 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4917 4331353 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4918 4331355 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB