RegulonDB RegulonDB 10.9: Gene Form
   

yjjB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yjjP yjjQ dnaT yjjB bglJ H-NS H-NS yjjQp yjjQp yjjPp yjjPp yjjBp yjjBp dnaTp dnaTp TSS_5159 TSS_5159 TSS_5158 TSS_5158 TSS_5157 TSS_5157

Gene      
Name: yjjB    Texpresso search in the literature
Synonym(s): ECK4353, EG11215, b4363
Genome position(nucleotides): 4601624 <-- 4602097 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.05
External database links:  
ASAP:
ABE-0014310
ECHOBASE:
EB1199
ECOLIHUB:
yjjB
OU-MICROARRAY:
b4363
STRING:
511145.b4363
COLOMBOS: yjjB


Product      
Name: putative succinate exporter YjjB
Synonym(s): YjjB
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 17.047
Isoelectric point: 10.526
Motif(s):
 
Type Positions Sequence
13 -> 147 DMILAAIPAVGFAMVFNVPVRALRWCALLGSIGHGSRMILMTSGLNIEWSTFMASMLVGTIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISAVKISQLGYSEPLMITLLTNFLTASSIVGALSIGLSIPG
50 -> 70 MILMTSGLNIEWSTFMASMLV
87 -> 107 VFTVAAVIPMFPGISAYTAMI
129 -> 149 FLTASSIVGALSIGLSIPGLW
154 -> 157 RPRV

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.9.B - Putative uncharacterized transport protein
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
biological_process GO:0006970 - response to osmotic stress
GO:0015744 - succinate transport
GO:1901652 - response to peptide
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11215-MONOMER
ECOLIWIKI:
b4363
INTERPRO:
IPR020914
INTERPRO:
IPR024528
PFAM:
PF12821
PRIDE:
P0ADD2
REFSEQ:
NP_418783
UNIPROT:
P0ADD2


Operon      
Name: yjjB-dnaTC-yjjA         
Operon arrangement:
Transcription unit        Promoter
dnaTC
dnaTC-yjjA
yjjB-dnaTC
yjjB-dnaTC-yjjA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5157 4601522 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_5158 4601548 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_5159 4601557 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB