RegulonDB RegulonDB 10.8: Gene Form
   

fdnH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fdnG fdnH fdnI C0362 Cis-reg

Gene      
Name: fdnH    Texpresso search in the literature
Synonym(s): ECK1469, EG11228, b1475
Genome position(nucleotides): 1550461 --> 1551345 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.03
External database links:  
ASAP:
ABE-0004919
CGSC:
32164
ECHOBASE:
EB1210
OU-MICROARRAY:
b1475
PortEco:
fdnH
STRING:
511145.b1475
COLOMBOS: fdnH


Product      
Name: formate dehydrogenase N subunit β
Synonym(s): FdnH
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 32.239
Isoelectric point: 5.753
Motif(s):
 
Type Positions Sequence
257 -> 279 LKPLAAAGFIATFAGLIFHYIGI
91 -> 123 LEWLIRKDGCMHCEDPGCLKACPSAGAIIQYAN
124 -> 153 GIVDFQSENCIGCGYCIAGCPFNIPRLNKE
38 -> 50 TCIGCKACQVACS
246 -> 289 IDTSVSLWKGALKPLAAAGFIATFAGLIFHYIGIGPNKEVDDDE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.1 - electron donors
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
GO:0009326 - formate dehydrogenase complex
GO:0071575 - integral component of external side of plasma membrane
molecular_function GO:0009055 - electron transfer activity
GO:0046872 - metal ion binding
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0036397 - formate dehydrogenase (quinone) activity
biological_process GO:0045333 - cellular respiration
GO:0009061 - anaerobic respiration
GO:0022900 - electron transport chain
GO:0055114 - oxidation-reduction process
GO:0015944 - formate oxidation
Note(s): Note(s): ...[more].
Reference(s): [1] Borgese N., et al., 2010
External database links:  
DIP:
DIP-35836N
ECOCYC:
FDNH-MONOMER
ECOLIWIKI:
b1475
INTERPRO:
IPR006470
INTERPRO:
IPR038384
INTERPRO:
IPR017900
INTERPRO:
IPR017896
INTERPRO:
IPR015246
INTERPRO:
IPR014603
MINT:
MINT-1286317
MODBASE:
P0AAJ3
PANTHER:
PTHR43545:SF3
PDB:
1KQG
PDB:
1KQF
PFAM:
PF09163
PFAM:
PF13247
PFAM:
PF12800
PRIDE:
P0AAJ3
PRODB:
PRO_000022582
PROSITE:
PS00198
PROSITE:
PS51379
REFSEQ:
NP_415992
SMR:
P0AAJ3
UNIPROT:
P0AAJ3


Operon      
Name: fdnGHI         
Operon arrangement:
Transcription unit        Promoter
fdnGHI


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, NarL
Repressed by: FNR, NarP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Borgese N., Righi M., 2010, Remote origins of tail-anchored proteins., Traffic 11(7):877-85


RegulonDB