RegulonDB RegulonDB 10.8: Gene Form
   

ycaC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ycaD dmsC ycaC anti-terminator anti-anti-terminator ycaDp6 ycaDp6 ycaDp1 ycaDp1

Gene      
Name: ycaC    Texpresso search in the literature
Synonym(s): ECK0888, EG11241, b0897
Genome position(nucleotides): 944931 <-- 945557 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.25
Reference(s): [1] Colovos C., et al., 1998
External database links:  
ASAP:
ABE-0003050
ECHOBASE:
EB1223
OU-MICROARRAY:
b0897
PortEco:
ycaC
STRING:
511145.b0897
COLOMBOS: ycaC


Product      
Name: putative hydrolase
Synonym(s): YcaC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 23.1
Isoelectric point: 5.041
Motif(s):
 
Type Positions Sequence
14 -> 165 AVLLVDHQAGLLSLVRDIEPDKFKNNVLALGDLAKYFNLPTILTTSFETGPNGPLVPELKAQFPDTPYIARPGNINAWDNEDFVKAVKATGKKQLIIAGVVTEVCVAFPALSAIEEGFDVFVVTDASGTFNEITRHSAWDRLSQAGAQLMTW

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016787 - hydrolase activity
GO:0016829 - lyase activity
GO:0042802 - identical protein binding
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11462N
ECOCYC:
EG11241-MONOMER
ECOLIWIKI:
b0897
INTERPRO:
IPR000868
INTERPRO:
IPR036380
MODBASE:
P21367
PDB:
1YAC
PFAM:
PF00857
PRIDE:
P21367
REFSEQ:
NP_415417
SMR:
P21367
UNIPROT:
P21367


Operon      
Name: ycaC         
Operon arrangement:
Transcription unit        Promoter
ycaC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ycaDp1 945719 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ycaDp6 945839 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Colovos C., Cascio D., Yeates TO., 1998, The 1.8 A crystal structure of the ycaC gene product from Escherichia coli reveals an octameric hydrolase of unknown specificity., Structure 6(10):1329-37

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB