RegulonDB RegulonDB 10.9: Gene Form
   

chpS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ppa chpB ytfP yzfA chpS anti-anti-terminator anti-terminator terminator terminator anti-terminator anti-anti-terminator TSS_5080 (cluster) TSS_5080 (cluster) TSS_5079 TSS_5079 TSS_5078 TSS_5078 chpSp2 chpSp2 chpSp1 chpSp1 yzfAp2 yzfAp2 TSS_5077 TSS_5077

Gene      
Name: chpS    Texpresso search in the literature
Synonym(s): ECK4220, EG11250, b4224, chpBI, yjfB
Genome position(nucleotides): 4448447 --> 4448698 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.4
External database links:  
ASAP:
ABE-0013820
CGSC:
33293
ECHOBASE:
EB1230
ECOLIHUB:
chpS
OU-MICROARRAY:
b4224
STRING:
511145.b4224
COLOMBOS: chpS


Product      
Name: ChpS antitoxin of the ChpB-ChpS toxin-antitoxin system
Synonym(s): ChpBI, ChpS, YjfB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 9.272
Isoelectric point: 4.418
Motif(s):
 
Type Positions Sequence
6 -> 49 KRWGNSAGMVIPNIVMKELNLQPGQSVEAQVSNNQLILTPISRR
3 -> 48 ITIKRWGNSAGMVIPNIVMKELNLQPGQSVEAQVSNNQLILTPISR

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.10 - defense/survival
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0097351 - toxin-antitoxin pair type II binding
biological_process GO:0030307 - positive regulation of cell growth
Note(s): Note(s): ...[more].
Reference(s): [1] Weiss DL., et al., 1986
External database links:  
DIP:
DIP-9280N
ECOCYC:
EG11250-MONOMER
ECOLIWIKI:
b4224
INTERPRO:
IPR039052
INTERPRO:
IPR037914
INTERPRO:
IPR007159
MODBASE:
P08365
PANTHER:
PTHR40516
PFAM:
PF04014
PRIDE:
P08365
PRODB:
PRO_000022286
PROSITE:
PS51740
REFSEQ:
NP_418645
SMART:
SM00966
SMR:
P08365
UNIPROT:
P08365


Operon      
Name: chpSB         
Operon arrangement:
Transcription unit        Promoter
chpSB
chpSB


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5077 4447908 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_5078 4448430 forward nd [RS-EPT-CBR] [2]
  promoter TSS_5079 4448709 forward nd [RS-EPT-CBR] [2]
  promoter TSS_5080 (cluster) 4449647 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Weiss DL., Johnson DI., Weith HL., Somerville RL., 1986, Structural analysis of the ileR locus of Escherichia coli K12., J Biol Chem 261(21):9966-71

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB