RegulonDB RegulonDB 10.9: Gene Form
   

cmk gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rpsA ycaL cmk IHF IHF IHF IHF IHF DksA-ppGpp DksA-ppGpp DksA-ppGpp DksA-ppGpp anti-terminator anti-anti-terminator TSS_1187 (cluster) TSS_1187 (cluster) TSS_1186 (cluster) TSS_1186 (cluster) TSS_1185 (cluster) TSS_1185 (cluster) TSS_1184 TSS_1184 TSS_1183 TSS_1183 TSS_1182 (cluster) TSS_1182 (cluster) TSS_1181 TSS_1181 TSS_1180 TSS_1180 TSS_1179 (cluster) TSS_1179 (cluster) rpsAp3 rpsAp3 TSS_1178 TSS_1178 rpsAp1 rpsAp1 cmkp cmkp

Gene      
Name: cmk    Texpresso search in the literature
Synonym(s): ECK0901, EG11265, b0910, mssA, ycaF, ycaG
Genome position(nucleotides): 961201 --> 961884 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.65
External database links:  
ASAP:
ABE-0003101
CGSC:
31736
ECHOBASE:
EB1244
ECOLIHUB:
cmk
OU-MICROARRAY:
b0910
STRING:
511145.b0910
COLOMBOS: cmk


Product      
Name: cytidylate kinase
Synonym(s): Cmk, MssA, YcaF, YcaG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 24.746
Isoelectric point: 5.652
Motif(s):
 
Type Positions Sequence
164 -> 164 E
8 -> 221 ITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHHVDVASEDALVPLASHLDVRFVSTNGNLEVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLRRQRAFRELPGLIADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQEKGFSVNFERLLAEIKERDDRDRNRAVAPLVPAADALVLDSTTLSIEQVIEKALQYAR
12 -> 20 GPSGAGKGT

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.2 - nucleotides --> 1.5.2.4 - pyrimidine ribonucleotide biosynthesis
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.33 - nucleotide and nucleoside conversions
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004127 - cytidylate kinase activity
biological_process GO:0010165 - response to X-ray
GO:0046940 - nucleoside monophosphate phosphorylation
GO:0006139 - nucleobase-containing compound metabolic process
GO:0006220 - pyrimidine nucleotide metabolic process
GO:0015949 - nucleobase-containing small molecule interconversion
GO:0016310 - phosphorylation
Note(s): Note(s): ...[more].
Reference(s): [1] Sargentini NJ., et al., 2016
External database links:  
ECOCYC:
CMPKI-MONOMER
ECOLIWIKI:
b0910
INTERPRO:
IPR027417
INTERPRO:
IPR003136
INTERPRO:
IPR011994
MODBASE:
P0A6I0
PDB:
1KDO
PDB:
2FEO
PDB:
2FEM
PDB:
2CMK
PDB:
1KDT
PDB:
1KDR
PDB:
1CKE
PDB:
1KDP
PFAM:
PF02224
PRIDE:
P0A6I0
PRODB:
PRO_000022301
REFSEQ:
NP_415430
SMR:
P0A6I0
UNIPROT:
P0A6I0


Operon      
Name: cmk-rpsA-ihfB         
Operon arrangement:
Transcription unit        Promoter
cmk-rpsA
rpsA-ihfB
rpsA-ihfB
ihfB
ihfB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1178 961718 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1179 (cluster) 961893 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1180 961899 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1181 962373 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1182 (cluster) 962813 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1183 962831 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1184 962837 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1185 (cluster) 963236 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1186 (cluster) 963240 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1187 (cluster) 963362 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Sargentini NJ., Gularte NP., Hudman DA., 2016, Screen for genes involved in radiation survival of Escherichia coli and construction of a reference database., Mutat Res 793-794:1-14

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB