RegulonDB RegulonDB 10.10: Gene Form
   

yhdH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

csrD yhdH accB yrdE yrdF b3254 FadR accBp2 accBp2 accBp accBp TSS_3590 TSS_3590 TSS_3589 TSS_3589 TSS_3588 TSS_3588 TSS_3587 TSS_3587 TSS_3586 TSS_3586 yhdHp6 yhdHp6 csrDp4 csrDp4 yhdHp1 yhdHp1 TSS_3584 TSS_3584

Gene      
Name: yhdH    Texpresso search in the literature
Synonym(s): ECK3241, EG11315, acuI, b3253
Genome position(nucleotides): 3403484 --> 3404458 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.38
External database links:  
ASAP:
ABE-0010667
ECHOBASE:
EB1291
ECOLIHUB:
yhdH
OU-MICROARRAY:
b3253
STRING:
511145.b3253
COLOMBOS: yhdH


Product      
Name: acrylyl-CoA reductase
Synonym(s): AcuI, YhdH
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 34.724
Isoelectric point: 5.715
Motif(s):
 
Type Positions Sequence
28 -> 85 GDVTVDVHWSSLNYKDALAITGKGKIIRNFPMIPGIDFAGTVRTSEDPRFHAGQEVLL
156 -> 159 SGGV
178 -> 180 SGR
158 -> 280 GVGSTAVALLHKLGYQVVAVSGRESTHEYLKSLGASRVLPRDEFAESRPLEKQVWAGAIDTVGDKVLAKVLAQMNYGGCVAACGLAGGFTLPTTVMPFILRNVRLQGVDSVMTPPERRAQAWQ

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0042803 - protein homodimerization activity
GO:0043957 - acryloyl-CoA reductase (NADP+) activity
External database links:  
DIP:
DIP-12295N
ECOCYC:
EG11315-MONOMER
ECOLIWIKI:
b3253
INTERPRO:
IPR013149
INTERPRO:
IPR013154
INTERPRO:
IPR011032
INTERPRO:
IPR014188
INTERPRO:
IPR036291
INTERPRO:
IPR020843
MODBASE:
P26646
PANTHER:
PTHR43677:SF1
PDB:
1O8C
PDB:
1O89
PFAM:
PF00107
PFAM:
PF08240
PRIDE:
P26646
REFSEQ:
NP_417719
SMART:
SM00829
SMR:
P26646
SWISSMODEL:
P26646
UNIPROT:
P26646


Operon      
Name: yhdH         
Operon arrangement:
Transcription unit        Promoter
yhdH


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3584 3403230 forward nd [RS-EPT-CBR] [1]
  promoter yhdHp1 3403280 forward nd [ICWHO] [2]
  promoter csrDp4 3403425 reverse nd [ICWHO] [2]
  promoter yhdHp6 3403446 forward nd [ICWHO], [RS-EPT-CBR] [1], [2]
  promoter TSS_3586 3403448 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3587 3403450 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3588 3403453 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3589 3403932 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3590 3404746 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB