RegulonDB RegulonDB 10.9: Gene Form
   

waaG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

waaG waaQ waaS waaP rirA Cis-reg rirAp rirAp waaQp waaQp TSS_4211 TSS_4211 TSS_4210 (cluster) TSS_4210 (cluster)

Gene      
Name: waaG    Texpresso search in the literature
Synonym(s): ECK3621, EG11339, b3631, rfaG
Genome position(nucleotides): 3805943 <-- 3807067 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.8
External database links:  
ASAP:
ABE-0011868
CGSC:
15583
ECHOBASE:
EB1315
ECOLIHUB:
rfaG
NCBI-GENE:
948149
OU-MICROARRAY:
b3631
STRING:
511145.b3631
COLOMBOS: waaG


Product      
Name: lipopolysaccharide glucosyltransferase I
Synonym(s): RfaG, WaaG
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 42.284
Isoelectric point: 7.673
Motif(s):
 
Type Positions Sequence
13 -> 173 FGGLQRDFMRIASTVAARGHHVRVYTQSWEGDCPKAFELIQVPVKSHTNHGRNAEYYAWVQNHLKEHPADRVVGFNKMPGLDVYFAADVCYAEKVAQEKGFLYRLTSRYRHYAAFERATFEQGKSTKLMMLTDKQIADFQKHYQTEPERFQILPPGIYPDR
183 -> 350 REIYRQKNGIKEQQNLLLQVGSDFGRKGVDRSIEALASLPESLRHNTLLFVVGQDKPRKFEALAEKLGVRSNVHFFSGRNDVSELMAAADLLLHPAYQEAAGIVLLEAITAGLPVLTTAVCGYAHYIADANCGTVIAEPFSQEQLNEVLRKALTQSPLRMAWAENARH

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.3 - lipopolysaccharide --> 1.6.3.2 - core region
  6 - cell structure --> 6.3 - surface antigens (ECA, O antigen of LPS)
Gene Ontology Terms (GO)  
molecular_function GO:0016757 - transferase activity, transferring glycosyl groups
GO:0016740 - transferase activity
GO:0008919 - lipopolysaccharide glucosyltransferase I activity
biological_process GO:0009103 - lipopolysaccharide biosynthetic process
GO:0009244 - lipopolysaccharide core region biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
CAZY:
GT4
ECOCYC:
EG11339-MONOMER
ECOLIWIKI:
b3631
INTERPRO:
IPR001296
INTERPRO:
IPR028098
MODBASE:
P25740
PDB:
2N58
PDB:
2IV7
PDB:
2IW1
PFAM:
PF00534
PFAM:
PF13439
PRIDE:
P25740
PRODB:
PRO_000023719
REFSEQ:
NP_418088
SMR:
P25740
UNIPROT:
P25740


Operon      
Name: rirA-waaQGPSBOJYZU         
Operon arrangement:
Transcription unit        Promoter
rfaYZ
rfaQGPSBIJYZ-waaU
rirA-rfaQGPSBIJYZ-waaU
rfaZ-waaU


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4210 (cluster) 3804751 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_4211 3807069 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB