RegulonDB RegulonDB 10.9: Gene Form
   

waaP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

waaG waaQ waaS waaP TSS_4211 TSS_4211 TSS_4210 (cluster) TSS_4210 (cluster)

Gene      
Name: waaP    Texpresso search in the literature
Synonym(s): ECK3620, EG11340, b3630, rfaP
Genome position(nucleotides): 3805153 <-- 3805950 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
43.36
External database links:  
ASAP:
ABE-0011866
CGSC:
298
ECHOBASE:
EB1316
ECOL199310CYC:
C4454
ECOLIHUB:
rfaP
NCBI-GENE:
948150
OU-MICROARRAY:
b3630
STRING:
511145.b3630
COLOMBOS: waaP


Product      
Name: lipopolysaccharide core heptose (I) kinase
Synonym(s): L-glycero-D-manno-heptose (I) kinase, RfaP, WaaP
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 30.872
Isoelectric point: 10.584
Motif(s):
 
Type Positions Sequence
20 -> 230 EVKKLNGEVFRELETRRTLRFELSGKSYFLKWHKGTTLKEIIKNLLSLRMPVLGADREWHAIHRLSDVGVDTMKGIGFGEKGLNPLTRASFIITEDLTPTISLEDYCADWAVNPPDIRVKRMLIARVATMVRKMHTAGINHRDCYICHFLLHLPFTGREDELKISVIDLHRAQIRAKVPRRWRDKDLIGLYFSSMNIGLTQRDIWRFMKVY
162 -> 162 D

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.3 - lipopolysaccharide --> 1.6.3.2 - core region
  6 - cell structure --> 6.3 - surface antigens (ECA, O antigen of LPS)
Gene Ontology Terms (GO)  
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
biological_process GO:0009103 - lipopolysaccharide biosynthetic process
GO:0009244 - lipopolysaccharide core region biosynthetic process
GO:0016310 - phosphorylation
GO:0046835 - carbohydrate phosphorylation
Note(s): Note(s): ...[more].
Reference(s): [1] Austin EA., et al., 1990
[2] Jahn LJ., et al., 2017
[3] Klena JD., et al., 1992
[4] Ren G., et al., 2016
[5] Roncero C., et al., 1992
[6] Wang Z., et al., 2015
External database links:  
ECOCYC:
EG11340-MONOMER
ECOLIWIKI:
b3630
INTERPRO:
IPR017172
INTERPRO:
IPR011009
PFAM:
PF06293
PRIDE:
P25741
PRODB:
PRO_000023724
REFSEQ:
NP_418087
SMR:
P25741
UNIPROT:
P25741


Operon      
Name: rirA-waaQGPSBOJYZU         
Operon arrangement:
Transcription unit        Promoter
rfaYZ
rfaQGPSBIJYZ-waaU
rirA-rfaQGPSBIJYZ-waaU
rfaZ-waaU


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4210 (cluster) 3804751 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [7]
  promoter TSS_4211 3807069 reverse nd [RS-EPT-CBR] [7]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Austin EA., Graves JF., Hite LA., Parker CT., Schnaitman CA., 1990, Genetic analysis of lipopolysaccharide core biosynthesis by Escherichia coli K-12: insertion mutagenesis of the rfa locus., J Bacteriol 172(9):5312-25

 [2] Jahn LJ., Munck C., Ellabaan MMH., Sommer MOA., 2017, Adaptive Laboratory Evolution of Antibiotic Resistance Using Different Selection Regimes Lead to Similar Phenotypes and Genotypes., Front Microbiol 8:816

 [3] Klena JD., Ashford RS., Schnaitman CA., 1992, Role of Escherichia coli K-12 rfa genes and the rfp gene of Shigella dysenteriae 1 in generation of lipopolysaccharide core heterogeneity and attachment of O antigen., J Bacteriol 174(22):7297-307

 [4] Ren G., Wang Z., Li Y., Hu X., Wang X., 2016, Effects of Lipopolysaccharide Core Sugar Deficiency on Colanic Acid Biosynthesis in Escherichia coli., J Bacteriol 198(11):1576-84

 [5] Roncero C., Casadaban MJ., 1992, Genetic analysis of the genes involved in synthesis of the lipopolysaccharide core in Escherichia coli K-12: three operons in the rfa locus., J Bacteriol 174(10):3250-60

 [6] Wang Z., Wang J., Ren G., Li Y., Wang X., 2015, Influence of Core Oligosaccharide of Lipopolysaccharide to Outer Membrane Behavior of Escherichia coli., Mar Drugs 13(6):3325-39

 [7] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB