RegulonDB RegulonDB 10.10: Gene Form
   

bax gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

malS xylR bax baxL MalT MalT MalT PhoP CRP terminator anti-terminator anti-anti-terminator malSp malSp TSS_4172 TSS_4172 baxp7 baxp7 baxp5 baxp5 TSS_4171 TSS_4171

Gene      
Name: bax    Texpresso search in the literature
Synonym(s): ECK3559, EG11360, b3570
Genome position(nucleotides): 3736353 <-- 3737177 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.24
External database links:  
ASAP:
ABE-0011655
ECHOBASE:
EB1335
ECOLIHUB:
bax
OU-MICROARRAY:
b3570
STRING:
511145.b3570
COLOMBOS: bax


Product      
Name: putative glycoside hydrolase Bax
Synonym(s): Bax
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 30.868
Isoelectric point: 11.023
Motif(s):
 
Type Positions Sequence
247 -> 254 GYSTKGKS
141 -> 267 TLLERVDIIPTSMVATMAAAESGWGTSKLARNNNNLFGMKCMKGRCTNAPGKVKGYSQFSSVKESVSAYVTNLNTHPAYSSFRKSRAQLRKADQEVTATAMIHKLKGYSTKGKSYNNYLFAMYQDNQ
181 -> 181 C

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
molecular_function GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004040 - amidase activity
Note(s): Note(s): ...[more].
External database links:  
CAZY:
GH73
ECOCYC:
EG11360-MONOMER
ECOLIWIKI:
b3570
INTERPRO:
IPR002901
PFAM:
PF01832
PRIDE:
P27297
REFSEQ:
YP_026230
SMART:
SM00047
UNIPROT:
P27297


Operon      
Name: bax         
Operon arrangement:
Transcription unit        Promoter
bax


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4171 3736974 reverse nd [RS-EPT-CBR] [1]
  promoter baxp5 3737221 reverse nd [ICWHO] [2]
  promoter baxp7 3737234 reverse nd [ICWHO] [2]
  promoter TSS_4172 3737240 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB