RegulonDB RegulonDB 10.8: Gene Form
   

barA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

barA gudD rlmD CRP HipB HipAB ppGpp TSS_3088 TSS_3088 rlmDp rlmDp TSS_3087 TSS_3087 relAp4 relAp4 relAp2 relAp2 relAp1 relAp1 relAp3 relAp3

Gene      
Name: barA    Texpresso search in the literature
Synonym(s): ECK2780, EG11367, airS, b2786
Genome position(nucleotides): 2915057 --> 2917813 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.84
External database links:  
ASAP:
ABE-0009131
CGSC:
33320
ECHOBASE:
EB1341
OU-MICROARRAY:
b2786
PortEco:
barA
STRING:
511145.b2786
COLOMBOS: barA


Product      
Name: sensor histidine kinase BarA
Synonym(s): AirS, BarA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 102.453
Isoelectric point: 5.385
Motif(s):
 
Type Positions Sequence
828 -> 908 DMLQMLLDFLPEVRNKVEEQLVGENPEGLVDLIHKLHGSCGYSGVPRMKNLCQLIEQQLRSGTKEEDLEPELLELLDEMDN
10 -> 31 MMILILAPTVLIGLLLSIFFVV
31 -> 177 VHRYNDLQRQLEDAGASIIEPLAVSTEYGMSLQNRESIGQLISVLHRRHSDIVRAISVYDENNRLFVTSNFHLDPSSMQLGSNVPFPRQLTVTRDGDIMILRTPIISESYSPDESPSSDAKNSQNMLGYIALELDLKSVRLQQYKEI
669 -> 785 TVMAVDDNPANLKLIGALLEDMVQHVELCDSGHQAVERAKQMPFDLILMDIQMPDMDGIRACELIHQLPHQQQTPVIAVTAHAMAGQKEKLLGAGMSDYLAKPIEEERLHNLLLRYK
299 -> 520 NMSHELRTPLNGVIGFTRLTLKTELTPTQRDHLNTIERSANNLLAIINDVLDFSKLEAGKLILESIPFPLRSTLDEVVTLLAHSSHDKGLELTLNIKSDVPDNVIGDPLRLQQIITNLVGNAIKFTENGNIDILVEKRALSNTKVQIEVQIRDTGIGIPERDQSRLFQAFRQADASISRRHGGTGLGLVITQKLVNEMGGDISFHSQPNRGSTFWFHINLDL

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.2 - covalent modification, demodification, maturation
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0016772 - transferase activity, transferring phosphorus-containing groups
GO:0016301 - kinase activity
GO:0004721 - phosphoprotein phosphatase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0000155 - phosphorelay sensor kinase activity
GO:0004673 - protein histidine kinase activity
GO:0042803 - protein homodimerization activity
GO:0009927 - histidine phosphotransfer kinase activity
biological_process GO:1901425 - response to formic acid
GO:0018217 - peptidyl-aspartic acid phosphorylation
GO:0010034 - response to acetate
GO:0006468 - protein phosphorylation
GO:0016310 - phosphorylation
GO:0042542 - response to hydrogen peroxide
GO:0000160 - phosphorelay signal transduction system
GO:0007165 - signal transduction
GO:0046777 - protein autophosphorylation
GO:0018106 - peptidyl-histidine phosphorylation
GO:0023014 - signal transduction by protein phosphorylation
External database links:  
DIP:
DIP-47932N
ECOCYC:
BARA-MONOMER
ECOLIWIKI:
b2786
INTERPRO:
IPR011006
INTERPRO:
IPR036890
INTERPRO:
IPR036641
INTERPRO:
IPR036097
INTERPRO:
IPR019247
INTERPRO:
IPR008207
INTERPRO:
IPR005467
INTERPRO:
IPR004358
INTERPRO:
IPR003661
INTERPRO:
IPR003660
INTERPRO:
IPR003594
INTERPRO:
IPR001789
MINT:
MINT-1307958
MODBASE:
P0AEC5
PFAM:
PF01627
PFAM:
PF00512
PFAM:
PF00672
PFAM:
PF00072
PFAM:
PF02518
PFAM:
PF09984
PRIDE:
P0AEC5
PRINTS:
PR00344
PRODB:
PRO_000022198
PROSITE:
PS50894
PROSITE:
PS50885
PROSITE:
PS50110
PROSITE:
PS50109
REFSEQ:
NP_417266
SMART:
SM00073
SMART:
SM00448
SMART:
SM00388
SMART:
SM00387
SMART:
SM00304
SMR:
P0AEC5
UNIPROT:
P0AEC5


Operon      
Name: barA         
Operon arrangement:
Transcription unit        Promoter
barA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3087 2915029 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3088 2916877 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB