RegulonDB RegulonDB 10.8: Gene Form
   

mltF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: mltF    Texpresso search in the literature
Synonym(s): ECK2556, EG11373, b2558, yfhD
Genome position(nucleotides): 2695801 --> 2697357 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.42
External database links:  
ASAP:
ABE-0008417
ECHOBASE:
EB1347
OU-MICROARRAY:
b2558
PortEco:
mltF
STRING:
511145.b2558
COLOMBOS: mltF


Product      
Name: membrane-bound lytic murein transglycosylase F
Synonym(s): MltF, YfhD
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,outer membrane
Molecular weight: 58.302
Isoelectric point: 5.169
Motif(s):
 
Type Positions Sequence
297 -> 402 KYAEEIDWRLLAAIAYQESHWDAQATSPTGVRGMMMLTKNTAQSLGITDRTDAEQSISGGVRYLQDMMSKVPESVPENERIWFALAAYNMGYAHMLDARALTAKTK
1 -> 21 MKKLKINYLFIGILALLLAVA
22 -> 269 LWPSIPWFGKADNRIAAIQARGELRVSTIHTPLTYNEINGKPFGLDYELAKQFADYLGVKLKVTVRQNISQLFDDLDNGNADLLAAGLVYNSERVKNYQPGPTYYSVSQQLVYKVGQYRPRTLGNLTAEQLTVAPGHVVVNDLQTLKETKFPELSWKVDDKKGSAELMEDVIEGKLDYTIADSVAISLFQRVHPELAVALDITDEQPVTWFSPLDGDNTLSAALLDFFNEMNEDGTLARIEEKYLGHG
150 -> 151 EQ
270 -> 518 DDFDYVDTRTFLRAVDAVLPQLKPLFEKYAEEIDWRLLAAIAYQESHWDAQATSPTGVRGMMMLTKNTAQSLGITDRTDAEQSISGGVRYLQDMMSKVPESVPENERIWFALAAYNMGYAHMLDARALTAKTKGNPDSWADVKQRLPLLSQKPYYSKLTYGYARGHEAYAYVENIRKYQISLVGYLQEKEKQATEAAMQLAQDYPAVSPTELGKEKFPFLSFLSQSSSNYLTHSPSLLFSRKGSEEKQN

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.2 - degradation of macromolecules --> 1.2.3 - proteins/peptides/glycopeptides
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
molecular_function GO:0016829 - lyase activity
GO:0008933 - lytic transglycosylase activity
GO:0016837 - carbon-oxygen lyase activity, acting on polysaccharides
biological_process GO:0000270 - peptidoglycan metabolic process
GO:0009253 - peptidoglycan catabolic process
GO:0016998 - cell wall macromolecule catabolic process
GO:0071555 - cell wall organization
Note(s): Note(s): ...[more].
Reference(s): [1] Blackburn NT., et al., 2001
[2] Dijkstra AJ., et al., 1996
[3] Koonin EV., et al., 1994
External database links:  
ECOCYC:
EG11373-MONOMER
ECOLIWIKI:
b2558
INTERPRO:
IPR000189
INTERPRO:
IPR023703
INTERPRO:
IPR023346
INTERPRO:
IPR008258
INTERPRO:
IPR001638
MODBASE:
P0AGC5
PANTHER:
PTHR21666:SF215
PFAM:
PF01464
PFAM:
PF00497
PRIDE:
P0AGC5
PRODB:
PRO_000023249
PROSITE:
PS00922
REFSEQ:
NP_417053
SMART:
SM00062
SMR:
P0AGC5
UNIPROT:
P0AGC5


Operon      
Name: mltF         
Operon arrangement:
Transcription unit        Promoter
mltF


Transcriptional Regulation      
Display Regulation             
Activated by: Rob


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2850 2694924 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_2852 2697755 reverse nd [RS-EPT-CBR] [4]



RegulonDB