RegulonDB RegulonDB 10.9: Gene Form
   

ahpC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ahpF dsbG ahpC MetJ MetJ OxyR OxyR OxyR OxyR terminator anti-terminator TSS_744 TSS_744 TSS_743 (cluster) TSS_743 (cluster) TSS_742 TSS_742 TSS_741 TSS_741 TSS_740 TSS_740 TSS_739 TSS_739 ahpFp ahpFp TSS_738 TSS_738 TSS_737 TSS_737 ahpCp ahpCp TSS_735 TSS_735 TSS_734 (cluster) TSS_734 (cluster) TSS_733 (cluster) TSS_733 (cluster) dsbGp dsbGp TSS_732 TSS_732 ahpCp2 ahpCp2 TSS_731 TSS_731 TSS_730 TSS_730

Gene      
Name: ahpC    Texpresso search in the literature
Synonym(s): ECK0599, EG11384, b0605, ssi8, tpx
Genome position(nucleotides): 638945 --> 639508 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.0
External database links:  
ASAP:
ABE-0002090
CGSC:
31190
ECHOBASE:
EB1357
ECOLIHUB:
ahpC
OU-MICROARRAY:
b0605
STRING:
511145.b0605
COLOMBOS: ahpC


Shine dalgarno      
Sequence: tcgaaaacacGGAGGAagtatagATG


Product      
Name: alkyl hydroperoxide reductase, AhpC component
Synonym(s): AhpC, Ssi8, Tpx, alkyl hydroperoxide reductase, C22 subunit
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 20.761
Isoelectric point: 4.8
Motif(s):
 
Type Positions Sequence
10 -> 133 PFKNQAFKNGEFIEITEKDTEGRWSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYAVSTDTHFTHKAWHSSSETIAKIKYAMIGDPTGALTRNFDNMREDEGLADRATFVVDPQGIIQA
155 -> 181 AQYVASHPGEVCPAKWKEGEATLAPSL
2 -> 187 SLINTKIKPFKNQAFKNGEFIEITEKDTEGRWSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYAVSTDTHFTHKAWHSSSETIAKIKYAMIGDPTGALTRNFDNMREDEGLADRATFVVDPQGIIQAIEVTAEGIGRDASDLLRKIKAAQYVASHPGEVCPAKWKEGEATLAPSLDLVGKI

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.2 - detoxification
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0009321 - alkyl hydroperoxide reductase complex
molecular_function GO:0102039 - alkylhydroperoxide reductase activity
GO:0005515 - protein binding
GO:0016491 - oxidoreductase activity
GO:0004601 - peroxidase activity
GO:0016209 - antioxidant activity
GO:0016684 - oxidoreductase activity, acting on peroxide as acceptor
GO:0008379 - thioredoxin peroxidase activity
GO:0051920 - peroxiredoxin activity
GO:0042802 - identical protein binding
GO:0032843 - hydroperoxide reductase activity
biological_process GO:0006979 - response to oxidative stress
GO:0019290 - siderophore biosynthetic process
GO:0009970 - cellular response to sulfate starvation
GO:0045454 - cell redox homeostasis
GO:0055114 - oxidation-reduction process
GO:0033194 - response to hydroperoxide
GO:0033195 - response to alkyl hydroperoxide
GO:0098869 - cellular oxidant detoxification
Note(s): Note(s): ...[more].
Reference(s): [1] Campos E., et al., 2007
[2] Dip PV., et al., 2014
[3] Jung IL., et al., 2003
[4] Kwon S., et al., 2008
[5] Lu C., et al., 2005
[6] Schurig-Briccio LA., et al., 2009
[7] Smillie DA., et al., 1992
[8] Wang X., et al., 2009
External database links:  
DIP:
DIP-36164N
ECOCYC:
EG11384-MONOMER
ECOLIWIKI:
b0605
INTERPRO:
IPR019479
INTERPRO:
IPR036249
INTERPRO:
IPR024706
INTERPRO:
IPR017559
INTERPRO:
IPR013766
INTERPRO:
IPR000866
MODBASE:
P0AE08
PANTHER:
PTHR10681:SF121
PDB:
5B8A
PDB:
5B8B
PFAM:
PF00578
PFAM:
PF10417
PRIDE:
P0AE08
PRODB:
PRO_000022070
PROSITE:
PS51352
REFSEQ:
NP_415138
SMR:
P0AE08
SWISSMODEL:
P0AE08
UNIPROT:
P0AE08


Operon      
Name: ahpCF         
Operon arrangement:
Transcription unit        Promoter
ahpCF
ahpCF
ahpF


Transcriptional Regulation      
Display Regulation             
Activated by: OxyR
Repressed by: MetJ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_730 638601 reverse nd [RS-EPT-CBR] [9]
  promoter TSS_731 638629 forward nd [RS-EPT-CBR] [9]
  promoter TSS_732 638782 reverse nd [RS-EPT-CBR] [9]
  promoter TSS_733 (cluster) 638831 forward For this promoter, there
Read more >
[RS-EPT-CBR] [9]
  promoter TSS_734 (cluster) 638834 forward For this promoter, there
Read more >
[RS-EPT-CBR] [9]
  promoter TSS_735 638918 forward nd [RS-EPT-CBR] [9]
  promoter TSS_737 638966 forward nd [RS-EPT-CBR] [9]
  promoter TSS_738 638974 forward nd [RS-EPT-CBR] [9]
  promoter TSS_739 639004 forward nd [RS-EPT-CBR] [9]
  promoter TSS_740 639027 forward nd [RS-EPT-CBR] [9]
  promoter TSS_741 639070 forward nd [RS-EPT-CBR] [9]
  promoter TSS_742 639766 forward nd [RS-EPT-CBR] [9]
  promoter TSS_743 (cluster) 640123 forward For this promoter, there
Read more >
[RS-EPT-CBR] [9]
  promoter TSS_744 640189 forward nd [RS-EPT-CBR] [9]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Campos E., Montella C., Garces F., Baldoma L., Aguilar J., Badia J., 2007, Aerobic L-ascorbate metabolism and associated oxidative stress in Escherichia coli., Microbiology 153(Pt 10):3399-408

 [2] Dip PV., Kamariah N., Nartey W., Beushausen C., Kostyuchenko VA., Ng TS., Lok SM., Saw WG., Eisenhaber F., Eisenhaber B., Gruber G., 2014, Key roles of the Escherichia coli AhpC C-terminus in assembly and catalysis of alkylhydroperoxide reductase, an enzyme essential for the alleviation of oxidative stress., Biochim Biophys Acta 1837(12):1932-1943

 [3] Jung IL., Kim IG., 2003, Transcription of ahpC, katG, and katE genes in Escherichia coli is regulated by polyamines: polyamine-deficient mutant sensitive to H2O2-induced oxidative damage., Biochem Biophys Res Commun 301(4):915-22

 [4] Kwon S., Jung Y., Lim D., 2008, Proteomic analysis of heat-stable proteins in Escherichia coli., BMB Rep 41(2):108-11

 [5] Lu C., Albano CR., Bentley WE., Rao G., 2005, Quantitative and kinetic study of oxidative stress regulons using green fluorescent protein., Biotechnol Bioeng 89(5):574-87

 [6] Schurig-Briccio LA., Farias RN., Rodriguez-Montelongo L., Rintoul MR., Rapisarda VA., 2009, Protection against oxidative stress in Escherichia coli stationary phase by a phosphate concentration-dependent genes expression., Arch Biochem Biophys 483(1):106-10

 [7] Smillie DA., Hayward RS., Suzuki T., Fujita N., Ishihama A., 1992, Locations of genes encoding alkyl hydroperoxide reductase on the physical map of the Escherichia coli K-12 genome., J Bacteriol 174(11):3826-7

 [8] Wang X., Zhao X., 2009, Contribution of oxidative damage to antimicrobial lethality., Antimicrob Agents Chemother 53(4):1395-402

 [9] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB