RegulonDB RegulonDB 10.9: Gene Form
   

ahpF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ahpF ahpC uspG MetJ terminator anti-terminator TSS_744 TSS_744 TSS_743 (cluster) TSS_743 (cluster) TSS_742 TSS_742 TSS_741 TSS_741 TSS_740 TSS_740 TSS_739 TSS_739 ahpFp ahpFp TSS_738 TSS_738 TSS_737 TSS_737

Gene      
Name: ahpF    Texpresso search in the literature
Synonym(s): ECK0600, EG11385, b0606
Genome position(nucleotides): 639753 --> 641318 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.13
External database links:  
ASAP:
ABE-0002093
CGSC:
31194
ECHOBASE:
EB1358
ECOLIHUB:
ahpF
OU-MICROARRAY:
b0606
STRING:
511145.b0606
COLOMBOS: ahpF


Product      
Name: alkyl hydroperoxide reductase, AhpF component
Synonym(s): AhpF, alkyl hydroperoxide reductase, F52a subunit
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 56.177
Isoelectric point: 5.397
Motif(s):
 
Type Positions Sequence
213 -> 499 YDVLIVGSGPAGAAAAIYSARKGIRTGLMGERFGGQILDTVDIENYISVPKTEGQKLAGALKVHVDEYDVDVIDSQSASKLIPAAVEGGLHQIETASGAVLKARSIIVATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKLRSLKNVDIILNAQTTEVKGDGSKVVGLEYRDRVSGDIHNIELAGIFVQIGLLPNTNWLEGAVERNRMGEIIIDAKCETNVKGVFAAGDCTTVPYKQIII
214 -> 229 DVLIVGSGPAGAAAAI
357 -> 371 RVAVIGGGNSGVEAA
126 -> 195 SLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGTFQNEITDRNVMGVPAVFVNGKEFGQGRMTLTEIVAKI
478 -> 488 TNVKGVFAAGD

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.2 - detoxification
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0009321 - alkyl hydroperoxide reductase complex
molecular_function GO:0009055 - electron transfer activity
GO:0016491 - oxidoreductase activity
GO:0050660 - flavin adenine dinucleotide binding
GO:0015035 - protein disulfide oxidoreductase activity
GO:0051287 - NAD binding
GO:0071949 - FAD binding
GO:0008785 - alkyl hydroperoxide reductase activity
biological_process GO:0000302 - response to reactive oxygen species
GO:0022900 - electron transport chain
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [1] Gomez-Sagasti MT., et al., 2014
[2] Ling J., et al., 2012
[3] Smillie DA., et al., 1992
External database links:  
DIP:
DIP-9077N
ECOCYC:
EG11385-MONOMER
ECOLIWIKI:
b0606
INTERPRO:
IPR036188
INTERPRO:
IPR008255
INTERPRO:
IPR012081
INTERPRO:
IPR012336
INTERPRO:
IPR023753
INTERPRO:
IPR002109
INTERPRO:
IPR036249
MODBASE:
P35340
PDB:
4YKG
PDB:
4O5U
PDB:
4XVG
PDB:
4O5Q
PDB:
4YKF
PDB:
1FL2
PFAM:
PF13192
PFAM:
PF07992
PRIDE:
P35340
PRODB:
PRO_000022071
PROSITE:
PS51354
PROSITE:
PS00573
REFSEQ:
NP_415139
SMR:
P35340
SWISSMODEL:
P35340
UNIPROT:
P35340


Operon      
Name: ahpCF         
Operon arrangement:
Transcription unit        Promoter
ahpCF
ahpCF
ahpF


Transcriptional Regulation      
Display Regulation             
Activated by: OxyR
Repressed by: MetJ


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_737 638966 forward nd [RS-EPT-CBR] [4]
  promoter TSS_738 638974 forward nd [RS-EPT-CBR] [4]
  promoter TSS_739 639004 forward nd [RS-EPT-CBR] [4]
  promoter TSS_740 639027 forward nd [RS-EPT-CBR] [4]
  promoter TSS_741 639070 forward nd [RS-EPT-CBR] [4]
  promoter TSS_742 639766 forward nd [RS-EPT-CBR] [4]
  promoter TSS_743 (cluster) 640123 forward For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_744 640189 forward nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Gomez-Sagasti MT., Becerril JM., Martin I., Epelde L., Garbisu C., 2014, cDNA microarray assessment of early gene expression profiles in Escherichia coli cells exposed to a mixture of heavy metals., Cell Biol Toxicol 30(4):207-32

 [2] Ling J., Cho C., Guo LT., Aerni HR., Rinehart J., Soll D., 2012, Protein aggregation caused by aminoglycoside action is prevented by a hydrogen peroxide scavenger., Mol Cell 48(5):713-22

 [3] Smillie DA., Hayward RS., Suzuki T., Fujita N., Ishihama A., 1992, Locations of genes encoding alkyl hydroperoxide reductase on the physical map of the Escherichia coli K-12 genome., J Bacteriol 174(11):3826-7

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB