RegulonDB RegulonDB 10.8: Gene Form
   

fliS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

amyA fliD fliS fliT TSS_2266 TSS_2266 amyAp amyAp

Gene      
Name: fliS    Texpresso search in the literature
Synonym(s): ECK1924, EG11388, b1925
Genome position(nucleotides): 2005303 --> 2005713 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.88
External database links:  
ASAP:
ABE-0006409
CGSC:
30736
ECHOBASE:
EB1361
OU-MICROARRAY:
b1925
PortEco:
fliS
STRING:
511145.b1925
COLOMBOS: fliS


Shine dalgarno      
Sequence: atattcatcgGGAGACaggtcATG


Product      
Name: flagellar biosynthesis protein FliS
Synonym(s): FliS
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 14.95
Isoelectric point: 4.38
Motif(s):
 
Type Positions Sequence
8 -> 124 QAYAQIGVESAVMSASQQQLVTMLFDGVLSALVRASLFMQDNNQQGKGVSLSKAINIIENGLRVSLDEESKDELTQNLIALYSYMVRRLLQANLRNDVSAVEEVEALMRNIADAWKE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.12 - flagellum
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
  6 - cell structure --> 6.4 - flagella
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
biological_process GO:0071973 - bacterial-type flagellum-dependent cell motility
GO:0044780 - bacterial-type flagellum assembly
GO:0044781 - bacterial-type flagellum organization
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Juhas M., et al., 2014
External database links:  
ECOCYC:
EG11388-MONOMER
ECOLIWIKI:
b1925
INTERPRO:
IPR036584
INTERPRO:
IPR003713
MODBASE:
P26608
PANTHER:
PTHR34773
PFAM:
PF02561
PRIDE:
P26608
PRODB:
PRO_000022668
REFSEQ:
NP_416435
SMR:
P26608
UNIPROT:
P26608


Operon      
Name: fliDST         
Operon arrangement:
Transcription unit        Promoter
fliDST
fliDST


Transcriptional Regulation      
Display Regulation             
Activated by: FlhDC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2266 2006132 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Juhas M., Evans LD., Frost J., Davenport PW., Yarkoni O., Fraser GM., Ajioka JW., 2014, Escherichia coli flagellar genes as target sites for integration and expression of genetic circuits., PLoS One 9(10):e111451

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB