RegulonDB RegulonDB 10.9: Gene Form
   

treC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nrdD treC treB mgtA5\' FNR FNR NrdR NrdR nrdDp nrdDp

Gene      
Name: treC    Texpresso search in the literature
Synonym(s): ECK4234, EG11402, b4239, olgH, treE
Genome position(nucleotides): 4463054 <-- 4464709 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.08
External database links:  
ASAP:
ABE-0013870
CGSC:
34597
ECHOBASE:
EB1374
ECOLIHUB:
treC
MIM:
220100
MIM:
606407
OU-MICROARRAY:
b4239
STRING:
511145.b4239
COLOMBOS: treC


Product      
Name: trehalose-6-phosphate hydrolase
Synonym(s): OlgH, TreC, TreE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 63.838
Isoelectric point: 5.677
Motif(s):
 
Type Positions Sequence
459 -> 548 YQKLIALRKQEAILTWGNYQDLLPNSPVLWCYRREWKGQTLLVIANLSREIQPWQAGQMRGNWQLVMHNYEEASPQPCAMNLRPFEAVWW
30 -> 372 GDLRGVIQHLDYLHKLGVDAIWLTPFYVSPQVDNGYDVANYTAIDPTYGTLDDFDELVTQAKSRGIRIILDMVFNHTSTQHAWFREALNKESPYRQFYIWRDGEPETPPNNWRSKFGGSAWRWHAESEQYYLHLFAPEQADLNWENPAVRAELKKVCEFWADRGVDGLRLDVVNLISKDPRFPEDLDGDGRRFYTDGPRAHEFLHEMNRDVFTPRGLMTVGEMSSTSLEHCQRYAALTGSELSMTFNFHHLKVDYPGGEKWTLAKPDFVALKTLFRHWQQGMHNVAWNALFWCNHDQPRIVSRFGDEGEYRVPAAKMLAMVLHGMQGTPYIYQGEEIGMTNPH
74 -> 74 D

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016787 - hydrolase activity
GO:0016798 - hydrolase activity, acting on glycosyl bonds
GO:0004556 - alpha-amylase activity
GO:0008788 - alpha,alpha-phosphotrehalase activity
biological_process GO:0008152 - metabolic process
GO:0005975 - carbohydrate metabolic process
GO:0006974 - cellular response to DNA damage stimulus
GO:0009313 - oligosaccharide catabolic process
GO:0005993 - trehalose catabolic process
Note(s): Note(s): ...[more].
External database links:  
CAZY:
GH13
DIP:
DIP-11024N
ECOCYC:
TRE6PHYDRO-MONOMER
ECOLIWIKI:
b4239
INTERPRO:
IPR013780
INTERPRO:
IPR022567
INTERPRO:
IPR017853
INTERPRO:
IPR012769
INTERPRO:
IPR006047
MODBASE:
P28904
PFAM:
PF11941
PFAM:
PF00128
PRIDE:
P28904
PRODB:
PRO_000024108
REFSEQ:
NP_418660
SMART:
SM00642
SMR:
P28904
SWISSMODEL:
P28904
UNIPROT:
P28904


Operon      
Name: treBC         
Operon arrangement:
Transcription unit        Promoter
treBC


Transcriptional Regulation      
Display Regulation             
Activated by: ArcA
Repressed by: CRP, TreR
Undetermined regulation CRP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB