RegulonDB RegulonDB 10.8: Gene Form
   

acs gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

acs nrfA yjcH actP Fis NarL FNR NarL IHF NsrR NarP NarL NarP NarL IHF NsrR IHF CRP Fis CRP Fis terminator TSS_4902 TSS_4902 nrfAp nrfAp acsp1 acsp1 acsp2 acsp2 actPp actPp

Gene      
Name: acs    Texpresso search in the literature
Synonym(s): ECK4062, EG11448, acsA, b4069, yfaC
Genome position(nucleotides): 4285413 <-- 4287371 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.87
External database links:  
ASAP:
ABE-0013337
CGSC:
34317
ECHOBASE:
EB1417
OU-MICROARRAY:
b4069
PortEco:
acs
STRING:
511145.b4069
COLOMBOS: acs


Product      
Name: acetyl-CoA synthetase (AMP-forming)
Synonym(s): Acs, AcsA, YfaC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 72.094
Isoelectric point: 5.588
Motif(s):
 
Type Positions Sequence
83 -> 522 DRHLQENGDRTAIIWEGDDASQSKHISYKELHRDVCRFANTLLELGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSNSRLVITSDEGVRAGRSIPLKKNVDDALKNPNVTSVEHVVVLKRTGGKIDWQEGRDLWWHDLVEQASDQHQAEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAALTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMAQVVDKHQVNILYTAPTAIRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVVDTWWQTETGGFMITPLPGATELKAGSATRPFFGVQPALVDNEGNPLEGATEGSLVITDSWPGQARTLFGDHERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNV
191 -> 194 RAGR
411 -> 416 DTWWQT
531 -> 609 EIESALVAHPKIAEAAVVGIPHNIKGQAIYAYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTDSLPKTRSGK
24 -> 81 YEAMYQQSINVPDTFWGEQGKILDWIKPYQKVKNTSFAPGNVSIKWYEDGTLNLAANC

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.2 - fatty acids
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.4 - fatty acids and phosphatidic acid
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.29 - acetate catabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0046872 - metal ion binding
GO:0016874 - ligase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0003987 - acetate-CoA ligase activity
GO:0050218 - propionate-CoA ligase activity
GO:0016208 - AMP binding
GO:0033558 - protein deacetylase activity
biological_process GO:0045733 - acetate catabolic process
GO:0006935 - chemotaxis
GO:0006476 - protein deacetylation
GO:0019427 - acetyl-CoA biosynthetic process from acetate
GO:0018394 - peptidyl-lysine acetylation
GO:0034421 - post-translational protein acetylation
Note(s): Note(s): ...[more].
Reference(s): [1] Baeza J., et al., 2014
[2] Canovas M., et al., 2003
[3] Castano-Cerezo S., et al., 2011
[4] Castano-Cerezo S., et al., 2014
[5] Castano-Cerezo S., et al., 2015
[6] Castano-Cerezo S., et al., 2009
[7] Gonidakis S., et al., 2010
[8] Gonidakis S., et al., 2010
[9] Lin H., et al., 2006
[10] Martinez-Gomez K., et al., 2012
[11] Nahku R., et al., 2010
[12] Nikolic N., et al., 2013
[13] Peebo K., et al., 2014
[14] Rahman M., et al., 2008
[15] Shin S., et al., 2009
[16] Sun M., et al., 2016
[17] Veit A., et al., 2007
External database links:  
ECOCYC:
ACS-MONOMER
ECOLIWIKI:
b4069
INTERPRO:
IPR000873
INTERPRO:
IPR042099
INTERPRO:
IPR032387
INTERPRO:
IPR025110
INTERPRO:
IPR020845
INTERPRO:
IPR011904
MODBASE:
P27550
PFAM:
PF00501
PFAM:
PF13193
PFAM:
PF16177
PRIDE:
P27550
PRODB:
PRO_000022052
PROSITE:
PS00455
REFSEQ:
NP_418493
SMR:
P27550
SWISSMODEL:
P27550
UNIPROT:
P27550


Operon      
Name: acs-yjcH-actP         
Operon arrangement:
Transcription unit        Promoter
actP
acs-yjcHG
acs-yjcHG


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: IHF, Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4902 4287672 forward nd [RS-EPT-CBR] [18]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Baeza J., Dowell JA., Smallegan MJ., Fan J., Amador-Noguez D., Khan Z., Denu JM., 2014, Stoichiometry of site-specific lysine acetylation in an entire proteome., J Biol Chem 289(31):21326-38

 [2] Canovas M., Bernal V., Torroglosa T., Ramirez JL., Iborra JL., 2003, Link between primary and secondary metabolism in the biotransformation of trimethylammonium compounds by escherichia coli., Biotechnol Bioeng 84(6):686-99

 [3] Castano-Cerezo S., Bernal V., Blanco-Catala J., Iborra JL., Canovas M., 2011, cAMP-CRP co-ordinates the expression of the protein acetylation pathway with central metabolism in Escherichia coli., Mol Microbiol 82(5):1110-28

 [4] Castano-Cerezo S., Bernal V., Post H., Fuhrer T., Cappadona S., Sanchez-Diaz NC., Sauer U., Heck AJ., Altelaar AF., Canovas M., 2014, Protein acetylation affects acetate metabolism, motility and acid stress response in Escherichia coli., Mol Syst Biol 10:762

 [5] Castano-Cerezo S., Bernal V., Rohrig T., Termeer S., Canovas M., 2015, Regulation of acetate metabolism in Escherichia coli BL21 by protein N(ε)-lysine acetylation., Appl Microbiol Biotechnol 99(8):3533-45

 [6] Castano-Cerezo S., Pastor JM., Renilla S., Bernal V., Iborra JL., Canovas M., 2009, An insight into the role of phosphotransacetylase (pta) and the acetate/acetyl-CoA node in Escherichia coli., Microb Cell Fact 8:54

 [7] Gonidakis S., Finkel SE., Longo VD., 2010, E. coli hypoxia-inducible factor ArcA mediates lifespan extension in a lipoic acid synthase mutant by suppressing acetyl-CoA synthetase., Biol Chem 391(10):1139-47

 [8] Gonidakis S., Finkel SE., Longo VD., 2010, Genome-wide screen identifies Escherichia coli TCA-cycle-related mutants with extended chronological lifespan dependent on acetate metabolism and the hypoxia-inducible transcription factor ArcA., Aging Cell 9(5):868-81

 [9] Lin H., Castro NM., Bennett GN., San KY., 2006, Acetyl-CoA synthetase overexpression in Escherichia coli demonstrates more efficient acetate assimilation and lower acetate accumulation: a potential tool in metabolic engineering., Appl Microbiol Biotechnol 71(6):870-4

 [10] Martinez-Gomez K., Flores N., Castaneda HM., Martinez-Batallar G., Hernandez-Chavez G., Ramirez OT., Gosset G., Encarnacion S., Bolivar F., 2012, New insights into Escherichia coli metabolism: carbon scavenging, acetate metabolism and carbon recycling responses during growth on glycerol., Microb Cell Fact 11:46

 [11] Nahku R., Valgepea K., Lahtvee PJ., Erm S., Abner K., Adamberg K., Vilu R., 2010, Specific growth rate dependent transcriptome profiling of Escherichia coli K12 MG1655 in accelerostat cultures., J Biotechnol 145(1):60-5

 [12] Nikolic N., Barner T., Ackermann M., 2013, Analysis of fluorescent reporters indicates heterogeneity in glucose uptake and utilization in clonal bacterial populations., BMC Microbiol 13:258

 [13] Peebo K., Valgepea K., Nahku R., Riis G., Oun M., Adamberg K., Vilu R., 2014, Coordinated activation of PTA-ACS and TCA cycles strongly reduces overflow metabolism of acetate in Escherichia coli., Appl Microbiol Biotechnol 98(11):5131-43

 [14] Rahman M., Hasan MR., Shimizu K., 2008, Growth phase-dependent changes in the expression of global regulatory genes and associated metabolic pathways in Escherichia coli., Biotechnol Lett 30(5):853-60

 [15] Shin S., Chang DE., Pan JG., 2009, Acetate consumption activity directly determines the level of acetate accumulation during Escherichia coli W3110 growth., J Microbiol Biotechnol 19(10):1127-34

 [16] Sun M., Xu J., Wu Z., Zhai L., Liu C., Cheng Z., Xu G., Tao S., Ye BC., Zhao Y., Tan M., 2016, Characterization of Protein Lysine Propionylation in Escherichia coli: Global Profiling, Dynamic Change, and Enzymatic Regulation., J Proteome Res 15(12):4696-4708

 [17] Veit A., Polen T., Wendisch VF., 2007, Global gene expression analysis of glucose overflow metabolism in Escherichia coli and reduction of aerobic acetate formation., Appl Microbiol Biotechnol 74(2):406-21

 [18] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB