RegulonDB RegulonDB 10.10: Gene Form
   

yigE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

uvrD yigE yigE5\' unknown ysgD TSS_4478 TSS_4478 corAp corAp TSS_4477 TSS_4477 TSS_4476 TSS_4476

Gene      
Name: yigE    Texpresso search in the literature
Synonym(s): ECK3809, EG11462, b3814, b3815, b4482
Genome position(nucleotides): 4000292 <-- 4001056 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.84
External database links:  
ASAP:
ABE-0174110
ECHOBASE:
EB1430
ECOLIHUB:
yigE
OU-MICROARRAY:
b3815
STRING:
511145.b4482
COLOMBOS: yigE


Product      
Name: DUF2233 domain-containing protein YigE
Synonym(s): YigE
Sequence: Get amino acid sequence Fasta Format
Cellular location: membrane
Molecular weight: 27.908
Isoelectric point: 9.194
Motif(s):
 
Type Positions Sequence
84 -> 234 QVQMAMNGGIYDESYAPLGLYIENGQQKVALNLASGEGNFFIRPGGVFYVAGDKVGIVRLDAFKTSKEIQFAVQSGPMLMENGVINPRIHPNVASSKIRNGVGINKHGNAVFLLSQQATNFYDFACYAKAKLNVEQLLYLDGTISHMYMKG

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11462-MONOMER
ECOLIWIKI:
b4482
INTERPRO:
IPR018711
PFAM:
PF09992
PRIDE:
P27840
REFSEQ:
YP_026261
UNIPROT:
P27840


Operon      
Name: yigE         
Operon arrangement:
Transcription unit        Promoter
yigE


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4474 3998622 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4475 3998664 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4476 4001066 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4477 4001192 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4478 4001273 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB