RegulonDB RegulonDB 10.10: Gene Form
   

hemG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rrsA trkH hemG Lrp Fis Lrp Fis Fis Fis DksA DksA-ppGpp DksA-ppGpp ppGpp TSS_4523 TSS_4523 rrsAp2 rrsAp2 rrsAp1 rrsAp1 TSS_4521 (cluster) TSS_4521 (cluster) TSS_4520 TSS_4520

Gene      
Name: hemG    Texpresso search in the literature
Synonym(s): ECK3842, EG11485, b3850, yihB
Genome position(nucleotides): 4034608 --> 4035153 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.83
External database links:  
ASAP:
ABE-0012577
CGSC:
642
ECHOBASE:
EB1448
ECOLIHUB:
hemG
OU-MICROARRAY:
b3850
STRING:
511145.b3850
COLOMBOS: hemG


Product      
Name: protoporphyrinogen oxidase
Synonym(s): HemG, YihB
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 21.226
Isoelectric point: 10.101
Motif(s):
 
Type Positions Sequence
84 -> 152 FYSVNLVARKPEKRTPQTNSYARKFLMNSQWRPDRCAVIAGALRYPRYRWYDRFMIKLIMKMSGGETDT
4 -> 152 LILFSTRDGQTREIASYLASELKELGIQADVANVHRIEEPQWENYDRVVIGASIRYGHYHSAFQEFVKKHATRLNSMPSAFYSVNLVARKPEKRTPQTNSYARKFLMNSQWRPDRCAVIAGALRYPRYRWYDRFMIKLIMKMSGGETDT
9 -> 13 TRDGQ
3 -> 172 TLILFSTRDGQTREIASYLASELKELGIQADVANVHRIEEPQWENYDRVVIGASIRYGHYHSAFQEFVKKHATRLNSMPSAFYSVNLVARKPEKRTPQTNSYARKFLMNSQWRPDRCAVIAGALRYPRYRWYDRFMIKLIMKMSGGETDTRKEVVYTDWEQVANFAREIA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.12 - heme, porphyrine
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0031234 - extrinsic component of cytoplasmic side of plasma membrane
molecular_function GO:0005515 - protein binding
GO:0009055 - electron transfer activity
GO:0016491 - oxidoreductase activity
GO:0000166 - nucleotide binding
GO:0004729 - oxygen-dependent protoporphyrinogen oxidase activity
GO:0010181 - FMN binding
GO:0042802 - identical protein binding
GO:0070819 - menaquinone-dependent protoporphyrinogen oxidase activity
biological_process GO:0006785 - heme B biosynthetic process
GO:0006779 - porphyrin-containing compound biosynthetic process
GO:0006783 - heme biosynthetic process
GO:0022900 - electron transport chain
GO:0006782 - protoporphyrinogen IX biosynthetic process
External database links:  
DIP:
DIP-35890N
ECOCYC:
PROTOPORGENOXI-MONOMER
ECOLIWIKI:
b3850
INTERPRO:
IPR026816
INTERPRO:
IPR029039
INTERPRO:
IPR008254
INTERPRO:
IPR001226
MODBASE:
P0ACB4
PFAM:
PF12724
PRIDE:
P0ACB4
PROSITE:
PS00201
PROSITE:
PS50902
REFSEQ:
NP_418292
UNIPROT:
P0ACB4


Operon      
Name: pepQ-yigZ-trkH-hemG         
Operon arrangement:
Transcription unit        Promoter
pepQ-yigZ-trkH-hemG


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4520 4034440 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4521 (cluster) 4034445 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4523 4035416 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB