RegulonDB RegulonDB 10.8: Gene Form
   

sra gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

maeA bdm sra ppGpp terminator srap srap maeAp3 maeAp3 maeAp4 maeAp4 adhPp5 adhPp5

Gene      
Name: sra    Texpresso search in the literature
Synonym(s): ECK1474, EG11508, b1480, rpsV
Genome position(nucleotides): 1555826 <-- 1555963 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.2
External database links:  
ASAP:
ABE-0004935
CGSC:
32198
ECHOBASE:
EB1471
OU-MICROARRAY:
b1480
PortEco:
sra
STRING:
511145.b1480
COLOMBOS: sra


Product      
Name: 30S ribosomal subunit protein S22
Synonym(s): Protein D, RpsV, Sra
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,ribosome
Molecular weight: 5.096
Isoelectric point: 11.696
Motif(s):
 
Type Positions Sequence
1 -> 44 MKSNRQARHILGLDHKISNQRKIVTEGDKSSVVNNPTGRKRPAE

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.2 - translation
  2 - information transfer --> 2.3 - protein related --> 2.3.8 - ribosomal proteins
  6 - cell structure --> 6.6 - ribosomes
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0005840 - ribosome
GO:0022627 - cytosolic small ribosomal subunit
molecular_function GO:0003735 - structural constituent of ribosome
biological_process GO:0006412 - translation
Note(s): Note(s): ...[more].
Reference(s): [1] Zhang S., et al., 2018
External database links:  
DIP:
DIP-48175N
ECOCYC:
EG11508-MONOMER
ECOLIWIKI:
b1480
INTERPRO:
IPR012607
MINT:
MINT-1322613
PFAM:
PF08136
PRIDE:
P68191
PRODB:
PRO_000023982
PRODOM:
PD049510
REFSEQ:
NP_415997
UNIPROT:
P68191


Operon      
Name: bdm-sra         
Operon arrangement:
Transcription unit        Promoter
sra
bdm-sra


Transcriptional Regulation      
Display Regulation             
Activated by: IHF, RcsB, Fis
Repressed by: OmpR


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter adhPp5 1553994 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter maeAp4 1555727 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter maeAp3 1555742 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Zhang S., Wunier W., Yao Y., Morigen M., 2018, Defects in ribosome function delay the initiation of chromosome replication in Escherichia coli., J Basic Microbiol

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB