RegulonDB RegulonDB 10.8: Gene Form
   

ybfD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybfL ybfD ybgA ybfQ phr LexA LexA terminator phrp phrp ybgAp1 ybgAp1 ybgAp2 ybgAp2

Gene      
Name: ybfD    Texpresso search in the literature
Synonym(s): ECK0695, EG11524, b0706
Genome position(nucleotides): 738092 --> 738853 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
39.63
External database links:  
ASAP:
ABE-0002411
ECHOBASE:
EB1486
ECOO157CYC:
Z2253
ECOO157CYC:
Z0857
ECOO157CYC:
Z2254
ECOO157CYC:
Z0700
ECOO157CYC:
Z0854
OU-MICROARRAY:
b0706
PortEco:
ybfD
STRING:
511145.b0706
COLOMBOS: ybfD


Product      
Name: H repeat-associated putative transposase YbfD
Synonym(s): YbfD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 28.865
Isoelectric point: 6.186
Motif(s):
 
Type Positions Sequence
7 -> 94 MEHISIIPDYRQAWKVEHKLSDILLLTICAVISGAEGWEDIEDFGETHPDFLKQYGDFENGIPVHDTIARVVSCICPAKFHESFINWM
102 -> 232 DKDVIAIDGKIHRHSYDKSRRKGAIHVISAFSTMHSLVIGQIKTDKKSNEITAIPELLNMLDIKGKIIKTDAMGCQKDIAEKIQKQGGDYLFAVKGNQGRLNKAFEEKFPLKELNNPKHDSYAISEKSHGR

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0004803 - transposase activity
biological_process GO:0006313 - transposition, DNA-mediated
Note(s): Note(s): ...[more].
Reference(s): [1] Zhao S., et al., 1993
External database links:  
ECOCYC:
EG11524-MONOMER
ECOLIWIKI:
b0706
ECOO157CYC:
Z2253-MONOMER
ECOO157CYC:
Z2254-MONOMER
ECOO157CYC:
Z0857-MONOMER
ECOO157CYC:
Z0854-MONOMER
ECOO157CYC:
Z0700-MONOMER
INTERPRO:
IPR032806
INTERPRO:
IPR002559
PFAM:
PF01609
PFAM:
PF13808
PRIDE:
P28916
REFSEQ:
NP_415234
SMR:
P28916
UNIPROT:
P28916


Operon      
Name: ybfD         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Zhao S., Sandt CH., Feulner G., Vlazny DA., Gray JA., Hill CW., 1993, Rhs elements of Escherichia coli K-12: complex composites of shared and unique components that have different evolutionary histories., J Bacteriol 175(10):2799-808


RegulonDB