RegulonDB RegulonDB 10.9: Gene Form
   

caiA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

caiT caiB caiA TSS_81 TSS_81

Gene      
Name: caiA    Texpresso search in the literature
Synonym(s): ECK0040, EG11560, b0039, yaaO
Genome position(nucleotides): 39244 <-- 40386 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.89
External database links:  
ASAP:
ABE-0000139
CGSC:
36825
ECHOBASE:
EB1521
ECOLIHUB:
caiA
OU-MICROARRAY:
b0039
STRING:
511145.b0039
COLOMBOS: caiA


Product      
Name: crotonobetainyl-CoA reductase
Synonym(s): CaiA, YaaO
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 42.558
Isoelectric point: 4.825
Motif(s):
 
Type Positions Sequence
6 -> 108 NDEQELFVAGIRELMASENWEAYFAECDRDSVYPERFVKALADMGIDSLLIPEEHGGLDAGFVTLAAVWMELGRLGAPTYVLYQLPGGFNTFLREGTQEQIDK
123 -> 215 AITEPGAGSDVGSLKTTYTRRNGKIYLNGSKCFITSSAYTPYIVVMARDGASPDKPVYTEWFVDMSKPGIKVTKLEKLGLRMDSCCEITFDDV
227 -> 376 GNGFNRVKEEFDHERFLVALTNYGTAMCAFEDAARYANQRVQFGEAIGRFQLIQEKFAHMAIKLNSMKNMLYEAAWKADNGTITSGDAAMCKYFCANAAFEVVDSAMQVLGGVGIAGNHRISRFWRDLRVDRVSGGSDEMQILTLGRAVL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.2 - electron acceptors
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.22 - carnitine metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0016627 - oxidoreductase activity, acting on the CH-CH group of donors
GO:0050660 - flavin adenine dinucleotide binding
GO:0003995 - acyl-CoA dehydrogenase activity
GO:0052890 - oxidoreductase activity, acting on the CH-CH group of donors, with a flavin as acceptor
biological_process GO:0009437 - carnitine metabolic process
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [1] Arense P., et al., 2013
[2] Elssner T., et al., 2001
External database links:  
DIP:
DIP-9241N
ECOCYC:
CROBETREDUCT-MONOMER
ECOLIWIKI:
b0039
INTERPRO:
IPR009100
INTERPRO:
IPR013786
INTERPRO:
IPR023450
INTERPRO:
IPR036250
INTERPRO:
IPR037069
INTERPRO:
IPR006091
INTERPRO:
IPR006089
INTERPRO:
IPR009075
MODBASE:
P60584
PFAM:
PF00441
PFAM:
PF02771
PFAM:
PF02770
PRIDE:
P60584
PRODB:
PRO_000022241
PROSITE:
PS00072
PROSITE:
PS00073
REFSEQ:
NP_414581
SMR:
P60584
UNIPROT:
P60584


Operon      
Name: caiTABCDE         
Operon arrangement:
Transcription unit        Promoter
caiTABCDE
caiCDE


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, FNR, ArcA, CaiF
Repressed by: H-NS


Regulation by small RNA    
  Display Regulation
small RNA spf


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_81 38400 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Arense P., Bernal V., Charlier D., Iborra JL., Foulquie-Moreno MR., Canovas M., 2013, Metabolic engineering for high yielding L(-)-carnitine production in Escherichia coli., Microb Cell Fact 12:56

 [2] Elssner T., Engemann C., Baumgart K., Kleber HP., 2001, Involvement of coenzyme A esters and two new enzymes, an enoyl-CoA hydratase and a CoA-transferase, in the hydration of crotonobetaine to L-carnitine by Escherichia coli., Biochemistry 40(37):11140-8

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB