RegulonDB RegulonDB 10.8: Gene Form
   

fixA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

caiT fixB fixA CaiF CRP CaiF CaiF CRP CaiF ArcA ArcA FNR FNR CRP ArcA ArcA fixAp fixAp caiTp caiTp

Gene      
Name: fixA    Texpresso search in the literature
Synonym(s): ECK0042, EG11562, b0041, yaaQ
Genome position(nucleotides): 42403 --> 43173 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.53
Reference(s): [1] Eichler K., et al., 1994
External database links:  
ASAP:
ABE-0000145
ECHOBASE:
EB1523
MIM:
231680
OU-MICROARRAY:
b0041
PortEco:
fixA
STRING:
511145.b0041
COLOMBOS: fixA


Product      
Name: putative electron transfer flavoprotein FixA
Synonym(s): FixA, YaaQ, putative electron transfer flavoprotein subunit, ETFP adenine nucleotide-binding domain
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 27.144
Isoelectric point: 4.215
Motif(s):
 
Type Positions Sequence
28 -> 210 SKADAKISQYDLNAIEAACQLKQQAAEAQVTALSVGGKALTNAKGRKDVLSRGPDELIVVIDDQFEQALPQQTASALAAAAQKAGFDLILCGDGSSDLYAQQVGLLVGEILNIPAVNGVSKIISLTADTLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAAD
216 -> 217 EA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.4 - energy production/transport
Gene Ontology Terms (GO)  
molecular_function GO:0005515 - protein binding
GO:0009055 - electron transfer activity
biological_process GO:0009437 - carnitine metabolic process
GO:0042413 - carnitine catabolic process
GO:0022900 - electron transport chain
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
[IMP] Inferred from mutant phenotype
Reference(s): [2] Eichler K., et al., 1995
[3] Walt A., et al., 2002
External database links:  
ECOCYC:
EG11562-MONOMER
ECOLIWIKI:
b0041
INTERPRO:
IPR000049
INTERPRO:
IPR033948
INTERPRO:
IPR023463
INTERPRO:
IPR014730
INTERPRO:
IPR014729
INTERPRO:
IPR012255
MODBASE:
P60566
PANTHER:
PTHR21294
PFAM:
PF01012
PRIDE:
P60566
PRODB:
PRO_000022628
PROSITE:
PS01065
REFSEQ:
NP_414583
SMART:
SM00893
SMR:
P60566
UNIPROT:
P60566


Operon      
Name: fixABCX         
Operon arrangement:
Transcription unit        Promoter
fixABCX


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, FNR, CaiF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Eichler K., Bourgis F., Buchet A., Kleber HP., Mandrand-Berthelot MA., 1994, Molecular characterization of the cai operon necessary for carnitine metabolism in Escherichia coli., Mol Microbiol 13(5):775-86

 [2] Eichler K., Buchet A., Bourgis F., Kleber HP., Mandrand-Berthelot MA., 1995, The fix Escherichia coli region contains four genes related to carnitine metabolism., J Basic Microbiol 35(4):217-27

 [3] Walt A., Kahn ML., 2002, The fixA and fixB genes are necessary for anaerobic carnitine reduction in Escherichia coli., J Bacteriol 184(14):4044-7


RegulonDB