RegulonDB RegulonDB 10.8: Gene Form
   

djlA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

lptD djlA yabP yabQ terminator TSS_115 TSS_115 TSS_114 TSS_114 impp3 impp3 djlAp3 djlAp3 TSS_113 TSS_113 TSS_112 TSS_112 impp2 impp2 impp1 impp1 TSS_109 TSS_109 TSS_108 (cluster) TSS_108 (cluster) TSS_107 TSS_107 TSS_106 TSS_106 TSS_105 TSS_105 TSS_104 TSS_104 TSS_103 (cluster) TSS_103 (cluster) TSS_102 (cluster) TSS_102 (cluster) TSS_101 TSS_101 TSS_100 TSS_100 TSS_99 TSS_99 TSS_98 TSS_98 TSS_97 TSS_97 TSS_96 (cluster) TSS_96 (cluster)

Gene      
Name: djlA    Texpresso search in the literature
Synonym(s): ECK0056, EG11570, b0055, yabH
Genome position(nucleotides): 57364 --> 58179 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.7
External database links:  
ASAP:
ABE-0000187
ECHOBASE:
EB1530
OU-MICROARRAY:
b0055
PortEco:
djlA
STRING:
511145.b0055
COLOMBOS: djlA


Product      
Name: co-chaperone protein DjlA
Synonym(s): DjlA, YabH
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 30.579
Isoelectric point: 10.321
Motif(s):
 
Type Positions Sequence
208 -> 267 NVLGVKPTDDATTIKRAYRKLMSEHHPDKLVAKGLPPEMMEMAKQKAQEIQQAYELIKQQ
16 -> 16 M
47 -> 170 QRERQALFFATTFEVMGHLTKSKGRVTEADIHIASQLMDRMNLHGASRTAAQNAFRVGKSDNYPLREKMRQFRSVCFGRFDLIRMFLEIQIQAAFADGSLHPNERAVLYVIAEELGISRAQFDQ
15 -> 15 L
205 -> 271 DACNVLGVKPTDDATTIKRAYRKLMSEHHPDKLVAKGLPPEMMEMAKQKAQEIQQAYELIKQQKGFK

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0051087 - chaperone binding
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
Reference(s): [1] Genevaux P., et al., 2001
External database links:  
ECOCYC:
EG11570-MONOMER
ECOLIWIKI:
b0055
INTERPRO:
IPR023749
INTERPRO:
IPR007791
INTERPRO:
IPR001623
INTERPRO:
IPR029024
INTERPRO:
IPR036869
MODBASE:
P31680
PFAM:
PF05099
PFAM:
PF00226
PRIDE:
P31680
PRINTS:
PR00625
PRODB:
PRO_000022450
PROSITE:
PS50076
REFSEQ:
NP_414597
SMART:
SM00271
SMR:
P31680
UNIPROT:
P31680


Operon      
Name: djlA         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_96 (cluster) 54762 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_97 54765 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_98 54884 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_99 55120 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_100 55146 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_101 55785 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_102 (cluster) 55791 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_103 (cluster) 55800 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_104 55908 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_105 55916 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_106 55920 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_107 56036 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_108 (cluster) 56466 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_109 56724 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_112 57253 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_113 57261 forward nd [RS-EPT-CBR] [2]
  promoter djlAp3 57268 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_114 59042 forward nd [RS-EPT-CBR] [2]
  promoter TSS_115 59069 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Genevaux P., Wawrzynow A., Zylicz M., Georgopoulos C., Kelley WL., 2001, DjlA is a third DnaK co-chaperone of Escherichia coli, and DjlA-mediated induction of colanic acid capsule requires DjlA-DnaK interaction., J Biol Chem 276(11):7906-12

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB