RegulonDB RegulonDB 10.9: Gene Form
   

yabI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

araC yabI thiQ thiP yabIp yabIp

Gene      
Name: yabI    Texpresso search in the literature
Synonym(s): ECK0066, EG11571, b0065
Genome position(nucleotides): 71351 --> 72115 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.86
External database links:  
ASAP:
ABE-0000241
ECHOBASE:
EB1531
ECOLIHUB:
yabI
OU-MICROARRAY:
b0065
STRING:
511145.b0065
COLOMBOS: yabI


Product      
Name: DedA family protein YabI
Synonym(s): YabI
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 28.244
Isoelectric point: 10.467
Motif(s):
 
Type Positions Sequence
29 -> 49 LALVGLILPGTVLMAGLGALI
59 -> 79 AWLAGIIGCLMGDWISFWLGW
36 -> 159 LPGTVLMAGLGALIGSGELSFWHAWLAGIIGCLMGDWISFWLGWRFKKPLHRWSFLKKNKALLDKTEHALHQHSMFTILVGRFVGPTRPLVPMVAGMLDLPVAKFITPNIIGCLLWPPFYFLPG
8 -> 28 FITQSTVYSLMAVVLVAFLES
145 -> 165 IIGCLLWPPFYFLPGILAGAA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
biological_process GO:0043093 - FtsZ-dependent cytokinesis
GO:0010212 - response to ionizing radiation
Note(s): Note(s): ...[more].
Evidence: [IGI] Inferred from genetic interaction
Reference(s): [1] Thompkins K., et al., 2008
External database links:  
ECOCYC:
EG11571-MONOMER
ECOLIWIKI:
b0065
INTERPRO:
IPR032818
INTERPRO:
IPR032816
PANTHER:
PTHR30353
PFAM:
PF09335
PRIDE:
P30149
REFSEQ:
NP_414607
UNIPROT:
P30149


Operon      
Name: yabI         
Operon arrangement:
Transcription unit        Promoter
yabI


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Thompkins K., Chattopadhyay B., Xiao Y., Henk MC., Doerrler WT., 2008, Temperature sensitivity and cell division defects in an Escherichia coli strain with mutations in yghB and yqjA, encoding related and conserved inner membrane proteins., J Bacteriol 190(13):4489-500


RegulonDB