RegulonDB RegulonDB 10.9: Gene Form
   

basS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

proP basS basR pmrR eptA basSp4 basSp4 TSS_4921 TSS_4921 TSS_4920 TSS_4920 TSS_4919 TSS_4919 TSS_4918 TSS_4918 TSS_4917 TSS_4917 TSS_4916 TSS_4916 TSS_4915 TSS_4915 TSS_4914 TSS_4914

Gene      
Name: basS    Texpresso search in the literature
Synonym(s): ECK4105, EG11614, b4112, dgkR, pmrB
Genome position(nucleotides): 4332181 <-- 4333272 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.21
External database links:  
ASAP:
ABE-0013464
CGSC:
28171
ECHOBASE:
EB1571
ECOLIHUB:
basS
OU-MICROARRAY:
b4112
STRING:
511145.b4112
COLOMBOS: basS


Product      
Name: sensor histidine kinase BasS
Synonym(s): BasS, DgkR, PmrB
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 41.029
Isoelectric point: 6.376
Motif(s):
 
Type Positions Sequence
89 -> 141 RRITRPLAELQKELEARTADNLTPIAIHSATLEIEAVVSALNDLVSRLTSTLD
102 -> 102 L
61 -> 64 EIRE
149 -> 357 DVAHELRTPLAGVRLHLELLAKTHHIDVAPLVARLDQMMESVSQLLQLARAGQSFSSGNYQHVKLLEDVILPSYDELSTMLDQRQQTLLLPESAADITVQGDATLLRMLLRNLVENAHRYSPQGSNIMIKLQEDDGAVMAVEDEGPGIDESKCGELSKAFVRMDSRYGGIGLGLSIVSRITQLHHGQFFLQNRQETSGTRAWVRLKKDQ
36 -> 39 ESTE

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.2 - covalent modification, demodification, maturation
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0016740 - transferase activity
GO:0016772 - transferase activity, transferring phosphorus-containing groups
GO:0016301 - kinase activity
GO:0004721 - phosphoprotein phosphatase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0000155 - phosphorelay sensor kinase activity
GO:0004673 - protein histidine kinase activity
biological_process GO:0006470 - protein dephosphorylation
GO:0016310 - phosphorylation
GO:0000160 - phosphorelay signal transduction system
GO:0007165 - signal transduction
GO:0046777 - protein autophosphorylation
GO:0018106 - peptidyl-histidine phosphorylation
GO:0010041 - response to iron(III) ion
GO:0010043 - response to zinc ion
GO:0023014 - signal transduction by protein phosphorylation
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9202N
ECOCYC:
BASS-MONOMER
ECOLIWIKI:
b4112
INTERPRO:
IPR036890
INTERPRO:
IPR036097
INTERPRO:
IPR005467
INTERPRO:
IPR004358
INTERPRO:
IPR003661
INTERPRO:
IPR003660
INTERPRO:
IPR003594
MODBASE:
P30844
PFAM:
PF02518
PFAM:
PF00512
PRIDE:
P30844
PRINTS:
PR00344
PRODB:
PRO_000022200
PROSITE:
PS50109
PROSITE:
PS50885
REFSEQ:
NP_418536
SMART:
SM00388
SMART:
SM00304
SMART:
SM00387
SMR:
P30844
UNIPROT:
P30844


Operon      
Name: basRS         
Operon arrangement:
Transcription unit        Promoter
basRS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4914 4330838 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4915 4330987 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4916 4331343 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4917 4331353 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4918 4331355 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4919 4332618 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4920 4332748 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4921 4332753 reverse nd [RS-EPT-CBR] [1]
  promoter basSp4 4333477 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB