RegulonDB RegulonDB 10.9: Gene Form
   

cyaY gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cyaA yzcX cyaY yifL yifLp yifLp TSS_4467 TSS_4467 cyaYp5 cyaYp5

Gene      
Name: cyaY    Texpresso search in the literature
Synonym(s): ECK3801, EG11653, b3807
Genome position(nucleotides): 3993739 <-- 3994059 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.89
External database links:  
ASAP:
ABE-0012435
ECHOBASE:
EB1606
ECOLIHUB:
cyaY
OU-MICROARRAY:
b3807
STRING:
511145.b3807
COLOMBOS: cyaY


Product      
Name: frataxin CyaY
Synonym(s): CyaY
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 12.231
Isoelectric point: 4.012
Motif(s):
 
Type Positions Sequence
31 -> 31 D
1 -> 102 MNDSEFHRLADQLWLTIEERLDDWDGDSDIDCEINGGVLTITFENGSKIIINRQEPLHQVWLATKQGGYHFDLKGDEWICDRSGETFWDLLEQAATQQAGET
22 -> 22 D
61 -> 61 W
18 -> 18 E

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.19 - incorporation of metal ions
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0046872 - metal ion binding
GO:0005506 - iron ion binding
GO:0008198 - ferrous iron binding
GO:0008199 - ferric iron binding
biological_process GO:0016226 - iron-sulfur cluster assembly
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
[IMP] Inferred from mutant phenotype
Reference(s): [1] Adinolfi S., et al., 2002
[2] Popovic M., et al., 2015
[3] Roche B., et al., 2015
[4] di Maio D., et al., 2017
External database links:  
DIP:
DIP-9356N
ECOCYC:
EG11653-MONOMER
ECOLIWIKI:
b3807
INTERPRO:
IPR036524
INTERPRO:
IPR020895
INTERPRO:
IPR002908
MODBASE:
P27838
PANTHER:
PTHR16821
PDB:
2EFF
PDB:
2P1X
PDB:
1SOY
PDB:
1EW4
PFAM:
PF01491
PRIDE:
P27838
PRODB:
PRO_000022359
PROSITE:
PS01344
PROSITE:
PS50810
REFSEQ:
NP_418251
SMART:
SM01219
SMR:
P27838
UNIPROT:
P27838


Operon      
Name: cyaY         
Operon arrangement:
Transcription unit        Promoter
cyaY


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter cyaYp5 3994083 reverse Similarity to the consensus
Read more >
[ICWHO], [RS-EPT-CBR] [5], [6]
  promoter TSS_4467 3994491 forward nd [RS-EPT-CBR] [6]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Adinolfi S., Trifuoggi M., Politou AS., Martin S., Pastore A., 2002, A structural approach to understanding the iron-binding properties of phylogenetically different frataxins., Hum Mol Genet 11(16):1865-77

 [2] Popovic M., Sanfelice D., Pastore C., Prischi F., Temussi PA., Pastore A., 2015, Selective observation of the disordered import signal of a globular protein by in-cell NMR: the example of frataxins., Protein Sci 24(6):996-1003

 [3] Roche B., Huguenot A., Barras F., Py B., 2015, The iron-binding CyaY and IscX proteins assist the ISC-catalyzed Fe-S biogenesis in Escherichia coli., Mol Microbiol 95(4):605-23

 [4] di Maio D., Chandramouli B., Yan R., Brancato G., Pastore A., 2017, Understanding the role of dynamics in the iron sulfur cluster molecular machine., Biochim Biophys Acta 1861(1 Pt A):3154-3163

 [5] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [6] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB