RegulonDB RegulonDB 11.0: Gene Form
   

fliG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fliF fliI fliG fliH fliE intG FlhDC CsgD FlhDC CsgD fliFp2 fliFp2 fliFp1 fliFp1 fliEp2 fliEp2 fliEp1 fliEp1

Gene      
Name: fliG    Texpresso search in the literature
Synonym(s): ECK1937, EG11654, b1939, flaAII.2, flaBII
Genome position(nucleotides): 2014880 --> 2015875
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.62
External database links:  
ASAP:
ABE-0006456
CGSC:
18322
ECHOBASE:
EB1607
ECOLIHUB:
fliG
OU-MICROARRAY:
b1939
STRING:
511145.b1939
COLOMBOS: fliG


Product      
Name: flagellar motor switch protein FliG
Synonym(s): FliG
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cell projection
Molecular weight: 36.776
Isoelectric point: 4.418
Motif(s):
 
Type Positions Sequence Comment
3 -> 103 NLTGTDKSVILLMTIGEDRAAEVFKHLSQREVQTLSAAMANVTQISNKQLTDVLAEFEQEAEQFAALNINANDYLRSVLVKALGEERAASLLEDILETRDT
115 -> 186 PQSAADLIRDEHPQIIATILVHLKRAQAADILALFDERLRHDVMLRIATFGGVQPAALAELTEVLNGLLDGQ
125 -> 128 EHPQ UniProt: Part of the EHPQR-motif; Sequence Annotation Type: short sequence motif.
159 -> 170 LRIATFGGVQPA UniProt: In Ref. 1; AAA75241..
218 -> 323 VREFDGELAQKIIDEMFLFENLVDVDDRSIQRLLQEVDSESLLIALKGAEQPLREKFLRNMSQRAADILRDDLANRGPVRLSQVENEQKAILLIVRRLAETGEMVI

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.12 - flagellum
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
  6 - cell structure --> 6.4 - flagella
Gene Ontology Terms (GO)  
cellular_component GO:0120107 - bacterial-type flagellum rotor complex
GO:0009433 - bacterial-type flagellum basal body, C ring
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0009288 - bacterial-type flagellum
GO:0009425 - bacterial-type flagellum basal body
molecular_function GO:0005515 - protein binding
GO:0003774 - cytoskeletal motor activity
GO:0042802 - identical protein binding
biological_process GO:0006935 - chemotaxis
GO:0071973 - bacterial-type flagellum-dependent cell motility
GO:0071977 - bacterial-type flagellum-dependent swimming motility
GO:0044780 - bacterial-type flagellum assembly
GO:0097588 - archaeal or bacterial-type flagellum-dependent cell motility
Note(s): Note(s): ...[more].
Reference(s): [1] Ford KM., et al., 2018
[2] Graf SS., et al., 2021
[3] Lele PP., et al., 2015
[4] Lloyd SA., et al., 1997
[5] Lloyd SA., et al., 1996
[6] Lowder BJ., et al., 2005
[7] Marykwas DL., et al., 1996
[8] Onoue Y., et al., 2018
[9] Toker AS., et al., 1997
[10] Van Way SM., et al., 2004
External database links:  
ALPHAFOLD:
P0ABZ1
DIP:
DIP-408N
ECOCYC:
FLIG-FLAGELLAR-SWITCH-PROTEIN
ECOLIWIKI:
b1939
INTERPRO:
IPR000090
INTERPRO:
IPR028263
INTERPRO:
IPR032779
INTERPRO:
IPR023087
INTERPRO:
IPR011002
MINT:
P0ABZ1
MODBASE:
P0ABZ1
PANTHER:
PTHR30534
PFAM:
PF14842
PFAM:
PF14841
PFAM:
PF01706
PRIDE:
P0ABZ1
PRINTS:
PR00954
PRODB:
PRO_000022658
REFSEQ:
NP_416449
SMR:
P0ABZ1
UNIPROT:
P0ABZ1


Operon      
Name: fliFGHIJK         
Operon arrangement:
Transcription unit        Promoter
fliFGHIJK
fliFGHIJK


Transcriptional Regulation      
Display Regulation             
Activated by: FlhDC
Repressed by: PdeL, CsgD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Ford KM., Antani JD., Nagarajan A., Johnson MM., Lele PP., 2018, Switching and Torque Generation in Swarming E. coli., Front Microbiol 9:2197

 [2] Graf SS., Hong S., Muller P., Gennis R., von Ballmoos C., 2021, Energy transfer between the nicotinamide nucleotide transhydrogenase and ATP synthase of Escherichia coli., Sci Rep 11(1):21234

 [3] Lele PP., Berg HC., 2015, Switching of Bacterial Flagellar Motors Is Triggered by Mutant FliG., Biophys J 108(5):1275-80

 [4] Lloyd SA., Blair DF., 1997, Charged residues of the rotor protein FliG essential for torque generation in the flagellar motor of Escherichia coli., J Mol Biol 266(4):733-44

 [5] Lloyd SA., Tang H., Wang X., Billings S., Blair DF., 1996, Torque generation in the flagellar motor of Escherichia coli: evidence of a direct role for FliG but not for FliM or FliN., J Bacteriol 178(1):223-31

 [6] Lowder BJ., Duyvesteyn MD., Blair DF., 2005, FliG subunit arrangement in the flagellar rotor probed by targeted cross-linking., J Bacteriol 187(16):5640-7

 [7] Marykwas DL., Berg HC., 1996, A mutational analysis of the interaction between FliG and FliM, two components of the flagellar motor of Escherichia coli., J Bacteriol 178(5):1289-94

 [8] Onoue Y., Takekawa N., Nishikino T., Kojima S., Homma M., 2018, The role of conserved charged residues in the bidirectional rotation of the bacterial flagellar motor., Microbiologyopen 7(4):e00587

 [9] Toker AS., Macnab RM., 1997, Distinct regions of bacterial flagellar switch protein FliM interact with FliG, FliN and CheY., J Mol Biol 273(3):623-34

 [10] Van Way SM., Millas SG., Lee AH., Manson MD., 2004, Rusty, jammed, and well-oiled hinges: Mutations affecting the interdomain region of FliG, a rotor element of the Escherichia coli flagellar motor., J Bacteriol 186(10):3173-81


RegulonDB