RegulonDB RegulonDB 10.8: Gene Form
   

atoA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

atoC atoE atoB atoD atoA atoS IHF IHF AtoC AtoC atoDp atoDp

Gene      
Name: atoA    Texpresso search in the literature
Synonym(s): ECK2215, EG11670, b2222
Genome position(nucleotides): 2324109 --> 2324759 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.61
External database links:  
ASAP:
ABE-0007349
CGSC:
986
ECHOBASE:
EB1621
MIM:
245050
OU-MICROARRAY:
b2222
PortEco:
atoA
STRING:
511145.b2222
COLOMBOS: atoA


Product      
Name: acetyl-CoA:acetoacetyl-CoA transferase subunit β
Synonym(s): AtoA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 22.96
Isoelectric point: 5.931
Motif(s):
 
Type Positions Sequence
5 -> 179 QRIARRVAQELRDGDIVNLGIGLPTMVANYLPEGIHITLQSENGFLGLGPVTTAHPDLVNAGGQPCGVLPGAAMFDSAMSFALIRGGHIDACVLGGLQVDEEANLANWVVPGKMVPGMGGAMDLVTGSRKVIIAMEHCAKDGSAKILRRCTMPLTAQHAVHMLVTELAVFRFIDG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.2 - fatty acids
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0008410 - CoA-transferase activity
GO:0008775 - acetate CoA-transferase activity
biological_process GO:0006629 - lipid metabolic process
GO:0006631 - fatty acid metabolic process
GO:0019395 - fatty acid oxidation
GO:0046459 - short-chain fatty acid metabolic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
ATOA-MONOMER
ECOLIWIKI:
b2222
INTERPRO:
IPR037171
INTERPRO:
IPR012791
INTERPRO:
IPR004165
INTERPRO:
IPR004164
MODBASE:
P76459
PANTHER:
PTHR13707
PDB:
5DBN
PFAM:
PF01144
PRIDE:
P76459
PRODB:
PRO_000022180
PROSITE:
PS01274
REFSEQ:
NP_416726
SMART:
SM00882
SMR:
P76459
UNIPROT:
P76459


Operon      
Name: atoDAEB         
Operon arrangement:
Transcription unit        Promoter
atoDAEB


Transcriptional Regulation      
Display Regulation             
Activated by: AtoC, IHF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB