RegulonDB RegulonDB 10.9: Gene Form
   

viaA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

kup ravA viaA asnA FNR FNR anti-terminator anti-anti-terminator kupp3 kupp3 TSS_4359 TSS_4359 kupp2 kupp2 TSS_4358 TSS_4358 TSS_4357 TSS_4357 ravAp ravAp kupp1 kupp1 TSS_4356 TSS_4356 TSS_4355 TSS_4355 TSS_4354 TSS_4354 TSS_4353 TSS_4353 TSS_4352 TSS_4352 TSS_4351 TSS_4351

Gene      
Name: viaA    Texpresso search in the literature
Synonym(s): ECK3739, EG11730, b3745, yieD, yieD_1, yieD_2, yieM
Genome position(nucleotides): 3928152 <-- 3929603 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.75
External database links:  
ASAP:
ABE-0012244
ECHOBASE:
EB1681
ECOLIHUB:
viaA
OU-MICROARRAY:
b3745
STRING:
511145.b3745
COLOMBOS: viaA


Product      
Name: protein ViaA
Synonym(s): ViaA, YieD, YieM, stimulator of RavA ATPase activity
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,membrane
Molecular weight: 55.907
Isoelectric point: 6.44
Motif(s):
 
Type Positions Sequence
320 -> 457 GPFIVCVDTSGSMGGFNEQCAKAFCLALMRIALAENRRCYIMLFSTEIVRYELSGPQGIEQAIRFLSQQFRGGTDLASCFRAIMERLQSREWFDADAVVISDFIAQRLPDDVTSKVKELQRVHQHRFHAVAMSAHGKP

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
molecular_function GO:0005515 - protein binding
biological_process GO:0032781 - positive regulation of ATPase activity
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
Reference(s): [1] McBroom AJ., et al., 2006
[2] Snider J., et al., 2006
External database links:  
DIP:
DIP-47951N
ECOCYC:
EG11730-MONOMER
ECOLIWIKI:
b3745
INTERPRO:
IPR023481
INTERPRO:
IPR036465
INTERPRO:
IPR008912
INTERPRO:
IPR002035
MODBASE:
P0ADN0
PFAM:
PF05762
PRIDE:
P0ADN0
PRODB:
PRO_000024211
REFSEQ:
YP_026243
SMART:
SM00327
SMR:
P0ADN0
UNIPROT:
P0ADN0


Operon      
Name: ravA-viaA         
Operon arrangement:
Transcription unit        Promoter
ravA-viaA


Transcriptional Regulation      
Display Regulation             
Activated by: FNR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4351 3927155 forward nd [RS-EPT-CBR] [3]
  promoter TSS_4352 3927521 forward nd [RS-EPT-CBR] [3]
  promoter TSS_4353 3928691 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4354 3928821 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4355 3931076 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4356 3931080 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4357 3931130 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4358 3931158 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4359 3931257 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] McBroom AJ., Johnson AP., Vemulapalli S., Kuehn MJ., 2006, Outer membrane vesicle production by Escherichia coli is independent of membrane instability., J Bacteriol 188(15):5385-92

 [2] Snider J., Gutsche I., Lin M., Baby S., Cox B., Butland G., Greenblatt J., Emili A., Houry WA., 2006, Formation of a distinctive complex between the inducible bacterial lysine decarboxylase and a novel AAA+ ATPase., J Biol Chem 281(3):1532-46

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB