RegulonDB RegulonDB 10.9: Gene Form
   

ravA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

kup ravA viaA asnA FNR FNR anti-terminator anti-anti-terminator kupp3 kupp3 TSS_4359 TSS_4359 kupp2 kupp2 TSS_4358 TSS_4358 TSS_4357 TSS_4357 ravAp ravAp kupp1 kupp1 TSS_4356 TSS_4356 TSS_4355 TSS_4355 TSS_4354 TSS_4354 TSS_4353 TSS_4353 TSS_4352 TSS_4352 TSS_4351 TSS_4351

Gene      
Name: ravA    Texpresso search in the literature
Synonym(s): ECK3740, EG11731, b3746, yieN
Genome position(nucleotides): 3929597 <-- 3931093 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.7
External database links:  
ASAP:
ABE-0012247
ECHOBASE:
EB1682
ECOLIHUB:
ravA
OU-MICROARRAY:
b3746
STRING:
511145.b3746
COLOMBOS: ravA


Product      
Name: regulatory ATPase RavA
Synonym(s): RavA, YieN
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 56.389
Isoelectric point: 6.453
Motif(s):
 
Type Positions Sequence
41 -> 171 SVFLLGPPGIAKSLIARRLKFAFQNARAFEYLMTRFSTPEEVFGPLSIQALKDEGRYERLTSGYLPEAEIVFLDEIWKAGPAILNTLLTAINERQFRNGAHVEKIPMRLLVAASNELPEADSSLEALYDRM
227 -> 298 HVFELIFMLRQQLDKLPDAPYVSDRRWKKAIRLLQASAFFSGRSAVAPVDLILLKDCLWYDAQSLNLIQQQI
444 -> 497 GEIKQQLEELESDWRKQHALFSEQQKCLFIPGDWLGRIEASLQDVGAQIRQAQQ

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.4 - unknown
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0016887 - ATPase activity
GO:0042626 - ATPase-coupled transmembrane transporter activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0042802 - identical protein binding
biological_process GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12469N
ECOCYC:
EG11731-MONOMER
ECOLIWIKI:
b3746
INTERPRO:
IPR041538
INTERPRO:
IPR027417
INTERPRO:
IPR003593
INTERPRO:
IPR011704
INTERPRO:
IPR022547
INTERPRO:
IPR023671
MODBASE:
P31473
PDB:
3NBX
PDB:
6SZB
PDB:
6SZA
PDB:
6Q7L
PDB:
5FL2
PDB:
4UPF
PDB:
4UPB
PFAM:
PF07728
PFAM:
PF12592
PFAM:
PF17868
PRIDE:
P31473
PRODB:
PRO_000023680
REFSEQ:
NP_418202
SMART:
SM00382
SMR:
P31473
UNIPROT:
P31473


Operon      
Name: ravA-viaA         
Operon arrangement:
Transcription unit        Promoter
ravA-viaA


Transcriptional Regulation      
Display Regulation             
Activated by: FNR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4351 3927155 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4352 3927521 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4353 3928691 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4354 3928821 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4355 3931076 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4356 3931080 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4357 3931130 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4358 3931158 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4359 3931257 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB