RegulonDB RegulonDB 10.10: Gene Form
   

hsrA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hsrA rbsR rbsK yieP hsrAp6 hsrAp6 hsrAp4 hsrAp4

Gene      
Name: hsrA    Texpresso search in the literature
Synonym(s): ECK3748, EG11732, b3754, yieO
Genome position(nucleotides): 3939185 <-- 3940612 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.09
External database links:  
ASAP:
ABE-0012273
ECHOBASE:
EB1683
ECOLIHUB:
hsrA
OU-MICROARRAY:
b3754
STRING:
511145.b3754
COLOMBOS: hsrA


Product      
Name: putative transporter HsrA
Synonym(s): HsrA, YieO, multidrug efflux pump HsrA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 51.462
Isoelectric point: 10.935
Motif(s):
 
Type Positions Sequence
281 -> 301 VPFLMPLMLQVGFGYQAFIAG
78 -> 98 IFTLAVSLFTLGSLACALSNS
429 -> 449 FHYTFITMGIITVASAAMFML
17 -> 406 AMAFFMQALDATILNTALPAIAHSLNRSPLAMQSAIISYTLTVAMLIPVSGWLADRFGTRRIFTLAVSLFTLGSLACALSNSLPQLVVFRVIQGIGGAMMMPVARLALLRAYPRNELLPVLNFVAMPGLVGPILGPVLGGVLVTWATWHWIFLINIPIGIAGLLYARKHMPNFTTARRRFDITGFLLFGLSLVLFSSGIELFGEKIVASWIALTVIVTSIGLLLLYILHARRTPNPLISLDLFKTRTFSIGIVGNIATRLGTGCVPFLMPLMLQVGFGYQAFIAGCMMAPTALGSIIAKSMVTQVLRRLGYRHTLVGITVIIGLMIAQFSLQSPAMAIWMLILPLFILGMAMSTQFTAMNTITLADLTDDNASSGNSVLAVTQQLSISLG
139 -> 159 FVAMPGLVGPILGPVLGGVLV

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0022857 - transmembrane transporter activity
biological_process GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12470N
ECOCYC:
YIEO-MONOMER
ECOLIWIKI:
b3754
INTERPRO:
IPR020846
INTERPRO:
IPR036259
INTERPRO:
IPR011701
INTERPRO:
IPR004638
INTERPRO:
IPR001411
MODBASE:
P31474
PANTHER:
PTHR23501
PFAM:
PF07690
PRIDE:
P31474
PROSITE:
PS50850
REFSEQ:
NP_418210
UNIPROT:
P31474


Operon      
Name: yieP-hsrA         
Operon arrangement:
Transcription unit        Promoter
yieP-hsrA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter hsrAp4 3940643 reverse nd [ICWHO] [1]
  promoter hsrAp6 3940706 reverse nd [ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB