RegulonDB RegulonDB 11.0: Gene Form
   

yieP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rrsC hsrA yieP rbsR Fis Fis Fis DksA DksA DksA-ppGpp DksA-ppGpp DksA-ppGpp DksA-ppGpp ppGpp ppGpp TSS_4368 TSS_4368 rrsCp2 rrsCp2 rrsCp1 rrsCp1 rrsCp rrsCp TSS_4367 TSS_4367 hsrAp6 hsrAp6 hsrAp4 hsrAp4

Gene      
Name: yieP    Texpresso search in the literature
Synonym(s): ECK3749, EG11733, b3755
Genome position(nucleotides): 3940635 <-- 3941327
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.35
External database links:  
ASAP:
ABE-0012275
ECHOBASE:
EB1684
ECOLIHUB:
yieP
OU-MICROARRAY:
b3755
STRING:
511145.b3755
COLOMBOS: yieP


Product      
Name: DNA-binding transcriptional regulator YieP
Synonym(s): YieP
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 26.076
Isoelectric point: 6.084
Motif(s):
 
Type Positions Sequence Comment
12 -> 80 KNLSYVLAEKLAQRILKGEYEPGTILPGEIELGEQFGVSRTAVREAVKTLTAKGMVLPRPRIGTRVMPQ UniProt: HTH gntR-type.
18 -> 77 LAEKLAQRILKGEYEPGTILPGEIELGEQFGVSRTAVREAVKTLTAKGMVLPRPRIGTRV
40 -> 59 EIELGEQFGVSRTAVREAVK UniProt: H-T-H motif.
108 -> 226 LVMRICLEPQACLLAATVGTAEQKAHLNTLMAEMAALKENFRRERWIEVDMAWHEHIYEMSANPFLTSFASLFHSVYHTYFTSITSDTVIKLDLHQAIVDAIIQSDGDAAFKACQALLR
123 -> 123 A UniProt: In Ref. 1; AAA62108..

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.4 - unknown
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [AIFS] Automated inference of function from sequence
[IPI] Inferred from physical interaction
Reference(s): [1] Gao Y., et al., 2018
[2] Nguyen-Vo TP., et al., 2020
[3] Perez-Rueda E., et al., 2004
External database links:  
ALPHAFOLD:
P31475
ECOCYC:
EG11733-MONOMER
ECOLIWIKI:
b3755
INTERPRO:
IPR036390
INTERPRO:
IPR036388
INTERPRO:
IPR011711
INTERPRO:
IPR000524
INTERPRO:
IPR008920
MODBASE:
P31475
PFAM:
PF00392
PFAM:
PF07729
PRIDE:
P31475
PRINTS:
PR00035
PROSITE:
PS50949
REFSEQ:
YP_026245
SMART:
SM00895
SMART:
SM00345
SMR:
P31475
UNIPROT:
P31475


Operon      
Name: yieP-hsrA         
Operon arrangement:
Transcription unit        Promoter
yieP-hsrA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter hsrAp4 3940643 reverse nd [ICWHO] [4]
  promoter hsrAp6 3940706 reverse nd [ICWHO] [4]
  promoter TSS_4367 3941354 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_4368 3941693 forward nd [RS-EPT-CBR] [5]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Gao Y., Yurkovich JT., Seo SW., Kabimoldayev I., Drager A., Chen K., Sastry AV., Fang X., Mih N., Yang L., Eichner J., Cho BK., Kim D., Palsson BO., 2018, Systematic discovery of uncharacterized transcription factors in Escherichia coli K-12 MG1655., Nucleic Acids Res 46(20):10682-10696

 [2] Nguyen-Vo TP., Ko S., Ryu H., Kim JR., Kim D., Park S., 2020, Systems evaluation reveals novel transporter YohJK renders 3-hydroxypropionate tolerance in Escherichia coli., Sci Rep 10(1):19064

 [3] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB