RegulonDB RegulonDB 10.9: Gene Form
   

yghB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

metC yqhC yghB YqhC TSS_3317 TSS_3317 yghBp yghBp

Gene      
Name: yghB    Texpresso search in the literature
Synonym(s): ECK3001, EG11824, b3009
Genome position(nucleotides): 3153563 --> 3154222 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.06
External database links:  
ASAP:
ABE-0009882
ECHOBASE:
EB1771
ECOLIHUB:
yghB
OU-MICROARRAY:
b3009
STRING:
511145.b3009
COLOMBOS: yghB


Product      
Name: DedA family protein YghB
Synonym(s): YghB
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 24.134
Isoelectric point: 9.78
Motif(s):
 
Type Positions Sequence
48 -> 173 LPGDSLLILAGALIAQGVMDFLPTIAILTAAASLGCWLSYIQGRWLGNTKTVKGWLAQLPAKYHQRATCMFDRHGLLALLAGRFLAFVRTLLPTMAGISGLPNRRFQFFNWLSGLLWVSVVTSFGY
51 -> 51 D
68 -> 88 FLPTIAILTAAASLGCWLSYI
161 -> 181 GLLWVSVVTSFGYALSMIPFV
18 -> 38 ALADPHIVSVVYFVMFATLFL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.4 - energy production/transport
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0022857 - transmembrane transporter activity
biological_process GO:0042493 - response to drug
GO:0043093 - FtsZ-dependent cytokinesis
GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
Evidence: [IGI] Inferred from genetic interaction
Reference(s): [1] Kumar S., et al., 2014
[2] Thompkins K., et al., 2008
External database links:  
ECOCYC:
EG11824-MONOMER
ECOLIWIKI:
b3009
INTERPRO:
IPR032818
INTERPRO:
IPR032816
PANTHER:
PTHR30353
PFAM:
PF09335
PRIDE:
P0AA60
REFSEQ:
NP_417482
UNIPROT:
P0AA60


Operon      
Name: yghB         
Operon arrangement:
Transcription unit        Promoter
yghB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3317 3153632 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Kumar S., Doerrler WT., 2014, Members of the conserved DedA family are likely membrane transporters and are required for drug resistance in Escherichia coli., Antimicrob Agents Chemother 58(2):923-30

 [2] Thompkins K., Chattopadhyay B., Xiao Y., Henk MC., Doerrler WT., 2008, Temperature sensitivity and cell division defects in an Escherichia coli strain with mutations in yghB and yqjA, encoding related and conserved inner membrane proteins., J Bacteriol 190(13):4489-500

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB