RegulonDB RegulonDB 10.9: Gene Form
   

yihD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

srkA mobA yihD mobB CpxR terminator TSS_4532 TSS_4532 TSS_4531 TSS_4531 TSS_4530 (cluster) TSS_4530 (cluster) dsbAp dsbAp TSS_4528 TSS_4528 TSS_4527 TSS_4527 srkAp srkAp mobAp2 mobAp2 yihDp yihDp TSS_4525 (cluster) TSS_4525 (cluster) mobAp1 mobAp1

Gene      
Name: yihD    Texpresso search in the literature
Synonym(s): ECK3850, EG11830, b3858
Genome position(nucleotides): 4042069 --> 4042338 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.3
External database links:  
ASAP:
ABE-0012599
ECHOBASE:
EB1777
ECOLIHUB:
yihD
OU-MICROARRAY:
b3858
STRING:
511145.b3858
COLOMBOS: yihD


Product      
Name: DUF1040 domain-containing protein YihD
Synonym(s): YihD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 10.273
Isoelectric point: 4.889
Motif(s):
 
Type Positions Sequence
1 -> 86 MKCKRLNEVIELLQPAWQKEPDLNLLQFLQKLAKESGFDGELADLTDDILIYHLKMRDSAKDAVIPGLQKDYEEDFKTALLRARGV

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
Reference(s): [1] Wasinger VC., et al., 1998
External database links:  
ECOCYC:
EG11830-MONOMER
ECOLIWIKI:
b3858
INTERPRO:
IPR038134
INTERPRO:
IPR009383
PFAM:
PF06288
PRIDE:
P0ADP9
REFSEQ:
NP_418295
SMR:
P0ADP9
UNIPROT:
P0ADP9


Operon      
Name: yihD         
Operon arrangement:
Transcription unit        Promoter
yihD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4525 (cluster) 4042047 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_4527 4042399 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4528 4043252 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4530 (cluster) 4043383 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_4531 4043393 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4532 4043397 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Wasinger VC., Humphery-Smith I., 1998, Small genes/gene-products in Escherichia coli K-12., FEMS Microbiol Lett 169(2):375-82

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB