RegulonDB RegulonDB 10.9: Gene Form
   

yihF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yihF yihG dsbA terminator yihFp1 yihFp1 yihFp6 yihFp6 yihFp4 yihFp4

Gene      
Name: yihF    Texpresso search in the literature
Synonym(s): ECK3853, EG11832, b3861
Genome position(nucleotides): 4044199 --> 4045629 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
41.65
External database links:  
ASAP:
ABE-0012609
ECHOBASE:
EB1779
ECOLIHUB:
yihF
OU-MICROARRAY:
b3861
STRING:
511145.b3861
COLOMBOS: yihF


Product      
Name: DUF945 domain-containing protein YihF
Synonym(s): YihF, putative GTP-binding protein
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 52.637
Isoelectric point: 5.232
Motif(s):
 
Type Positions Sequence
4 -> 464 KSATGVIVALAVIWGGGTWYTGTQIQPGVEKFIKDFNDAKKKGEHAYDMTLSYQNFDKGFFNSRFQMQMTFDNGAPDLNIKPGQKVVFDVDVEHGPLPITMLMHGNVIPALAAAKVNLVNNELTQPLFIAAKNKSPVEATLRFAFGGSFSTTLDVAPAEYGKFSFGEGQFTFNGDGSSLSNLDIEGKVEDIVLQLSPMNKVTAKSFTIDSLARLEEKKFPVGESESKFNQINIINHGEDVAQIDAFVAKTRLDRVKDKDYINVNLTYELDKLTKGNQQLGSGEWSLIAESIDPSAVRQFIIQYNIAMQKQLAAHPELANDEVALQEVNAALFKEYLPLLQKSEPTIKQPVRWKNALGELNANLDISIADPAKSSSSTNKDIKSLNFDVKLPLNVVTETAKQLNLSEGMDAEKAQKQADKQISGMMTLGQMFQLITIDNNTASLQLRYTPGKVVFNGQEMSE
25 -> 476 GTQIQPGVEKFIKDFNDAKKKGEHAYDMTLSYQNFDKGFFNSRFQMQMTFDNGAPDLNIKPGQKVVFDVDVEHGPLPITMLMHGNVIPALAAAKVNLVNNELTQPLFIAAKNKSPVEATLRFAFGGSFSTTLDVAPAEYGKFSFGEGQFTFNGDGSSLSNLDIEGKVEDIVLQLSPMNKVTAKSFTIDSLARLEEKKFPVGESESKFNQINIINHGEDVAQIDAFVAKTRLDRVKDKDYINVNLTYELDKLTKGNQQLGSGEWSLIAESIDPSAVRQFIIQYNIAMQKQLAAHPELANDEVALQEVNAALFKEYLPLLQKSEPTIKQPVRWKNALGELNANLDISIADPAKSSSSTNKDIKSLNFDVKLPLNVVTETAKQLNLSEGMDAEKAQKQADKQISGMMTLGQMFQLITIDNNTASLQLRYTPGKVVFNGQEMSEEEFMSRAGRFVH
443 -> 443 T
1 -> 24 MIRKSATGVIVALAVIWGGGTWYT
316 -> 316 A

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11832-MONOMER
ECOLIWIKI:
b3861
INTERPRO:
IPR010352
PFAM:
PF06097
PRIDE:
P32128
REFSEQ:
NP_418298
UNIPROT:
P32128


Operon      
Name: yihF         
Operon arrangement:
Transcription unit        Promoter
yihF


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yihFp4 4044055 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yihFp6 4044131 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yihFp1 4044175 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB