RegulonDB RegulonDB 11.0: Gene Form
   

rhaA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rhaB rhaA rhaS rhaD RhaS RhaR RhaS RhaR CRP CRP CRP CRP RhaS RhaS rhaSp2 rhaSp2 rhaSp rhaSp rhaBp rhaBp rhaDp rhaDp

Gene      
Name: rhaA    Texpresso search in the literature
Synonym(s): ECK3896, EG11867, b3903
Genome position(nucleotides): 4094723 <-- 4095982
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.11
External database links:  
ASAP:
ABE-0012736
CGSC:
292
ECHOBASE:
EB1813
ECOLIHUB:
rhaA
OU-MICROARRAY:
b3903
STRING:
511145.b3903
COLOMBOS: rhaA


Product      
Name: L-rhamnose isomerase
Synonym(s): RhaA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 47.199
Isoelectric point: 5.575
Motif(s):
 
Type Positions Sequence Comment
3 -> 418 TQLEQAWELAKQRFAAVGIDVEEALRQLDRLPVSMHCWQGDDVSGFENPEGSLTGGIQATGNYPGKARNASELRADLEQAMRLIPGPKRLNLHAIYLESDTPVSRDQIKPEHFKNWVEWAKANQLGLDFNPSCFSHPLSADGFTLSHADDSIRQFWIDHCKASRRVSAYFGEQLGTPSVMNIWIPDGMKDITVDRLAPRQRLLAALDEVISEKLNPAHHIDAVESKLFGIGAESYTVGSNEFYMGYATSRQTALCLDAGHFHPTEVISDKISAAMLYVPQLLLHVSRPVRWDSDHVVLLDDETQAIASEIVRHDLFDRVHIGLDFFDASINRIAAWVIGTRNMKKALLRALLEPTAELRKLEAAGDYTARLALLEEQKSLPWQAVWEMYCQRHDTPAGSEWLESVRAYEKEILSRR
359 -> 360 EL UniProt: In Ref. 2; AAB03036..
366 -> 366 A UniProt: In Ref. 1; CAA43002..

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0032991 - protein-containing complex
molecular_function GO:0033296 - rhamnose binding
GO:0016853 - isomerase activity
GO:0046872 - metal ion binding
GO:0008270 - zinc ion binding
GO:0008740 - L-rhamnose isomerase activity
GO:0030145 - manganese ion binding
GO:0042802 - identical protein binding
biological_process GO:0019299 - rhamnose metabolic process
GO:0019301 - rhamnose catabolic process
GO:0019324 - L-lyxose metabolic process
GO:0051289 - protein homotetramerization
Note(s): Note(s): ...[more].
Reference(s): [1] Chen YM., et al., 1987
[2] Jung SM., et al., 2019
[3] Leang K., et al., 2004
[4] Moralejo P., et al., 1993
[5] Plunkett G., et al., 1993
[6] Sanchez JC., et al., 1994
[7] Sugiyama M., et al., 2007
[8] TECCE G., et al., 1956
[9] WILSON DM., et al., 1957
[10] Xu W., et al., 2016
External database links:  
ALPHAFOLD:
P32170
DIP:
DIP-10690N
DISPROT:
DP00429
ECOCYC:
RHAMNISOM-MONOMER
ECOLIWIKI:
b3903
INTERPRO:
IPR009308
INTERPRO:
IPR036237
MODBASE:
P32170
PDB:
1DE5
PDB:
1DE6
PDB:
1D8W
PFAM:
PF06134
PRIDE:
P32170
PRODB:
PRO_000023733
REFSEQ:
YP_026276
SMR:
P32170
UNIPROT:
P32170


Operon      
Name: rhaBAD         
Operon arrangement:
Transcription unit        Promoter
rhaD
rhaBAD


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, RhaS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Chen YM., Tobin JF., Zhu Y., Schleif RF., Lin EC., 1987, Cross-induction of the L-fucose system by L-rhamnose in Escherichia coli., J Bacteriol 169(8):3712-9

 [2] Jung SM., Chin YW., Lee YG., Seo JH., 2019, Enhanced production of 2'-fucosyllactose from fucose by elimination of rhamnose isomerase and arabinose isomerase in engineered Escherichia coli., Biotechnol Bioeng 116(9):2412-2417

 [3] Leang K., Maekawa K., Menavuvu BT., Morimoto K., Granstrom TB., Takada G., Izumori K., 2004, A novel enzymatic approach to the massproduction of L-galactose from L-sorbose., J Biosci Bioeng 97(6):383-8

 [4] Moralejo P., Egan SM., Hidalgo E., Aguilar J., 1993, Sequencing and characterization of a gene cluster encoding the enzymes for L-rhamnose metabolism in Escherichia coli., J Bacteriol 175(17):5585-94

 [5] Plunkett G., Burland V., Daniels DL., Blattner FR., 1993, Analysis of the Escherichia coli genome. III. DNA sequence of the region from 87.2 to 89.2 minutes., Nucleic Acids Res 21(15):3391-8

 [6] Sanchez JC., Gimenez R., Schneider A., Fessner WD., Baldoma L., Aguilar J., Badia J., 1994, Activation of a cryptic gene encoding a kinase for L-xylulose opens a new pathway for the utilization of L-lyxose by Escherichia coli., J Biol Chem 269(47):29665-9

 [7] Sugiyama M., Hong Z., Greenberg WA., Wong CH., 2007, In vivo selection for the directed evolution of L-rhamnulose aldolase from L-rhamnulose-1-phosphate aldolase (RhaD)., Bioorg Med Chem 15(17):5905-11

 [8] TECCE G., DI GIROLAMO M., 1956, [Various properties of L-rhamnose isomerase of E. coli]., Boll Soc Ital Biol Sper 32(9):1195-8

 [9] WILSON DM., AJL S., 1957, Metabolism of L-rhamnose by Escherichia coli. I. L-rhamnose isomerase., J Bacteriol 73(3):410-4

 [10] Xu W., Zhang W., Zhang T., Jiang B., Mu W., 2016, L-Rhamnose isomerase and its use for biotechnological production of rare sugars., Appl Microbiol Biotechnol 100(7):2985-92


RegulonDB